DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pug and AT4G00600

DIOPT Version :9

Sequence 1:NP_001014614.1 Gene:pug / 41279 FlyBaseID:FBgn0020385 Length:968 Species:Drosophila melanogaster
Sequence 2:NP_191969.1 Gene:AT4G00600 / 825813 AraportID:AT4G00600 Length:310 Species:Arabidopsis thaliana


Alignment Length:304 Identity:139/304 - (45%)
Similarity:184/304 - (60%) Gaps:43/304 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 WTAEPAIKMS---GAKIISGTAVAKSIREELRNEVTAMSKQLADFVPGLRIVQVGGREDSNVYIR 88
            |....:|:.|   .|.:|.|.|.||.||::::.||:.| |:....||.         |||     
plant    41 WRCTLSIRSSSSPSAIVIDGKAEAKKIRDDIKIEVSRM-KESIGVVPA---------EDS----- 90

  Fly    89 MKIKAATEIGIDAAHVQLPRSITEVELLDKINDLNEDPRVHGIIVQMPLDCDTPIDSHRITDAVS 153
                                  :|.|:|..::..|:||.|||::||:||  .:.:|...|.:|||
plant    91 ----------------------SEEEVLKYVSGFNDDPSVHGVLVQLPL--PSHMDEQNILNAVS 131

  Fly   154 PEKDVDGLHTVNEGRLAI-GDLGGFLPCTPWGCLELIRRSGVEIAGARAVVLGRSKIVGTPAAEL 217
            .||||||.|.:|.||||: |....|:||||.||:||:.|..:|..|.||||:|||.|||.|||.|
plant   132 IEKDVDGFHPLNIGRLAMRGREPLFVPCTPKGCIELLHRYNIEFKGKRAVVIGRSNIVGMPAALL 196

  Fly   218 LKWANATVTVCHSKTRNLEEITRSADILVVGIGVAEMVKGSWIKPGAVVIDCGINVKPDASKASG 282
            |:..:|||::.||:|.|.||:||.||||:..:|...||:|||||||||:||.||....|.|.|.|
plant   197 LQKEDATVSIIHSRTMNPEELTRQADILISAVGKPNMVRGSWIKPGAVLIDVGIKPVEDPSAAGG 261

  Fly   283 SKLVGDVDYAEALQVAGHLTPVPGGVGPMTVAMLMKNTVRSAAR 326
            .:||||:.|.||.::|..:|||||.|||||:|||:.||:.||.|
plant   262 ERLVGDICYVEASKIASAITPVPGDVGPMTIAMLLSNTLTSAKR 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pugNP_001014614.1 FolD 39..330 CDD:223268 135/289 (47%)
THF_DHG_CYH 40..159 CDD:279147 37/118 (31%)
NAD_bind_m-THF_DH_Cyclohyd 154..324 CDD:133448 98/170 (58%)
FTHFS 350..968 CDD:279592
AT4G00600NP_191969.1 PLN02616 1..310 CDD:215332 139/304 (46%)
THF_DHG_CYH 57..137 CDD:279147 37/118 (31%)
NAD_bind_m-THF_DH_Cyclohyd 132..304 CDD:133448 99/171 (58%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 196 1.000 Domainoid score I900
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100216
Panther 1 1.100 - - O PTHR48099
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.