DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pug and AT3G12290

DIOPT Version :9

Sequence 1:NP_001014614.1 Gene:pug / 41279 FlyBaseID:FBgn0020385 Length:968 Species:Drosophila melanogaster
Sequence 2:NP_187837.1 Gene:AT3G12290 / 820409 AraportID:AT3G12290 Length:299 Species:Arabidopsis thaliana


Alignment Length:290 Identity:159/290 - (54%)
Similarity:203/290 - (70%) Gaps:4/290 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 AKIISGTAVAKSIREELRNEVTAMSKQLADFVPGLRIVQVGGREDSNVYIRMKIKAATEIGIDAA 102
            ||||.|.|:|.:||.|:..||..:|::... ||||.:|.||.|:||..|:..|.||..|:||.:.
plant     9 AKIIDGKAIAHTIRSEIAEEVRGLSEKHGK-VPGLAVVIVGSRKDSQTYVNTKRKACAEVGIKSF 72

  Fly   103 HVQLPRSITEVELLDKINDLNEDPRVHGIIVQMPLDCDTPIDSHRITDAVSPEKDVDGLHTVNEG 167
            .|.||..::|.:|:.|:::||.:|.||||:||:||  ...|:...|..|:|.:|||||.|.:|.|
plant    73 DVGLPEEVSEADLISKVHELNSNPDVHGILVQLPL--PKHINEEHILGAISIDKDVDGFHPLNIG 135

  Fly   168 RLAI-GDLGGFLPCTPWGCLELIRRSGVEIAGARAVVLGRSKIVGTPAAELLKWANATVTVCHSK 231
            :||: |....||||||.|||||:.||||:|.|.||||:|||.|||.|.:.||..|:||||..||.
plant   136 KLAMKGREPLFLPCTPKGCLELLARSGVKIKGQRAVVVGRSNIVGLPVSLLLLKADATVTTVHSH 200

  Fly   232 TRNLEEITRSADILVVGIGVAEMVKGSWIKPGAVVIDCGINVKPDASKASGSKLVGDVDYAEALQ 296
            |::.|.|.|.|||::...|.|.|:||:||||||.|||.|.|...|.||.||.:||||||:|||.:
plant   201 TKDPEAIIREADIVIAACGQAHMIKGNWIKPGAAVIDVGTNAVSDPSKKSGYRLVGDVDFAEASK 265

  Fly   297 VAGHLTPVPGGVGPMTVAMLMKNTVRSAAR 326
            |||.:|||||||||||||||::|||..|.|
plant   266 VAGFITPVPGGVGPMTVAMLLRNTVDGAKR 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pugNP_001014614.1 FolD 39..330 CDD:223268 158/289 (55%)
THF_DHG_CYH 40..159 CDD:279147 51/118 (43%)
NAD_bind_m-THF_DH_Cyclohyd 154..324 CDD:133448 106/170 (62%)
FTHFS 350..968 CDD:279592
AT3G12290NP_187837.1 PLN02516 1..299 CDD:178131 159/290 (55%)
THF_DHG_CYH 11..127 CDD:279147 51/118 (43%)
NAD_bind_m-THF_DH_Cyclohyd 122..294 CDD:133448 106/171 (62%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 196 1.000 Domainoid score I900
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100216
Panther 1 1.100 - - O PTHR48099
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.