DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pug and AT2G38660

DIOPT Version :9

Sequence 1:NP_001014614.1 Gene:pug / 41279 FlyBaseID:FBgn0020385 Length:968 Species:Drosophila melanogaster
Sequence 2:NP_001118472.1 Gene:AT2G38660 / 818448 AraportID:AT2G38660 Length:352 Species:Arabidopsis thaliana


Alignment Length:288 Identity:139/288 - (48%)
Similarity:189/288 - (65%) Gaps:4/288 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 IISGTAVAKSIREELRNEVTAMSKQLADFVPGLRIVQVGGREDSNVYIRMKIKAATEIGIDAAHV 104
            :|.|..:|:.||.::.:||..|.|.:.. ||||.:|.||.:.||..|:|.||||..|.||.:...
plant    65 VIDGNVIAEEIRTKIISEVGKMKKAVGK-VPGLAVVLVGEQRDSQTYVRNKIKACEETGIKSVLA 128

  Fly   105 QLPRSITEVELLDKINDLNEDPRVHGIIVQMPLDCDTPIDSHRITDAVSPEKDVDGLHTVNEGRL 169
            :||...||.:::..:...|||..:|||:||:||  ...::..:|.:.|..||||||.|.:|.|.|
plant   129 ELPEDCTEGQIISVLRKFNEDTSIHGILVQLPL--PQHLNESKILNMVRLEKDVDGFHPLNVGNL 191

  Fly   170 AI-GDLGGFLPCTPWGCLELIRRSGVEIAGARAVVLGRSKIVGTPAAELLKWANATVTVCHSKTR 233
            |: |....|:.|||.||:||:.|:||||||..|||:|||.|||.|.:.||:..:|||:..|:.|:
plant   192 AMRGREPLFVSCTPKGCVELLIRTGVEIAGKNAVVIGRSNIVGLPMSLLLQRHDATVSTVHAFTK 256

  Fly   234 NLEEITRSADILVVGIGVAEMVKGSWIKPGAVVIDCGINVKPDASKASGSKLVGDVDYAEALQVA 298
            :.|.|||.|||::...|:..:|:|||:||||||||.|.....|:|...|.:|||||.|.|||.||
plant   257 DPEHITRKADIVIAAAGIPNLVRGSWLKPGAVVIDVGTTPVEDSSCEFGYRLVGDVCYEEALGVA 321

  Fly   299 GHLTPVPGGVGPMTVAMLMKNTVRSAAR 326
            ..:|||||||||||:.||:.||:.:|.|
plant   322 SAITPVPGGVGPMTITMLLCNTLEAAKR 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pugNP_001014614.1 FolD 39..330 CDD:223268 139/288 (48%)
THF_DHG_CYH 40..159 CDD:279147 46/118 (39%)
NAD_bind_m-THF_DH_Cyclohyd 154..324 CDD:133448 94/170 (55%)
FTHFS 350..968 CDD:279592
AT2G38660NP_001118472.1 PLN02897 8..352 CDD:178485 139/288 (48%)
THF_DHG_CYH 65..181 CDD:279147 46/118 (39%)
NAD_bind_m-THF_DH_Cyclohyd 177..348 CDD:133448 94/170 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 196 1.000 Domainoid score I900
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48099
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.