DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pug and AT2G12280

DIOPT Version :9

Sequence 1:NP_001014614.1 Gene:pug / 41279 FlyBaseID:FBgn0020385 Length:968 Species:Drosophila melanogaster
Sequence 2:NP_178929.1 Gene:AT2G12280 / 815699 AraportID:AT2G12280 Length:90 Species:Arabidopsis thaliana


Alignment Length:73 Identity:41/73 - (56%)
Similarity:50/73 - (68%) Gaps:0/73 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   886 TDAGFGNLPICMSKVSGSFTGDAKIKGAPKGFTLDVEDVYVSAGAGFVVAMCGEVTKMPGLPTRP 950
            |..||.||||||||...||:.||..||||.||.|.:.||..|.||||:..:.|.::.||||||||
plant     3 TQQGFSNLPICMSKTQYSFSHDASKKGAPSGFVLPIRDVRGSIGAGFIYPLVGTMSTMPGLPTRP 67

  Fly   951 AIYDIDLN 958
            ..|:||::
plant    68 CFYEIDIS 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pugNP_001014614.1 FolD 39..330 CDD:223268
THF_DHG_CYH 40..159 CDD:279147
NAD_bind_m-THF_DH_Cyclohyd 154..324 CDD:133448
FTHFS 350..968 CDD:279592 41/73 (56%)
AT2G12280NP_178929.1 PLN02759 <1..74 CDD:178359 40/70 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D690393at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.