powered by:
Protein Alignment pug and AT2G12200
DIOPT Version :9
Sequence 1: | NP_001014614.1 |
Gene: | pug / 41279 |
FlyBaseID: | FBgn0020385 |
Length: | 968 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_178923.1 |
Gene: | AT2G12200 / 815690 |
AraportID: | AT2G12200 |
Length: | 63 |
Species: | Arabidopsis thaliana |
Alignment Length: | 61 |
Identity: | 29/61 - (47%) |
Similarity: | 34/61 - (55%) |
Gaps: | 0/61 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 886 TDAGFGNLPICMSKVSGSFTGDAKIKGAPKGFTLDVEDVYVSAGAGFVVAMCGEVTKMPGL 946
|..||.||||||||...||:.|...|.||.||.|.:.||..|.||||:......|..:.|:
plant 3 TQQGFSNLPICMSKTQYSFSHDTSKKRAPSGFVLPIRDVRGSIGAGFIYTTKKTVNPLAGM 63
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D690393at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.920 |
|
Return to query results.
Submit another query.