DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pug and Mthfd2l

DIOPT Version :9

Sequence 1:NP_001014614.1 Gene:pug / 41279 FlyBaseID:FBgn0020385 Length:968 Species:Drosophila melanogaster
Sequence 2:XP_006535239.1 Gene:Mthfd2l / 665563 MGIID:1915871 Length:366 Species:Mus musculus


Alignment Length:297 Identity:128/297 - (43%)
Similarity:179/297 - (60%) Gaps:15/297 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 AKIISGTAVAKSIREELRNEVTAMSKQLADFVPGLRIVQVGGREDSNVYIRMKIKAATEIGIDAA 102
            |.|||||.:||.|::|::..|.:.. .|.:..|.|.|:.||....|:.|:|.|||||:.:||.:.
Mouse    70 AVIISGTNMAKQIQKEIQQGVESWI-ALGNRRPHLSIILVGDNPASHTYVRNKIKAASAVGICSE 133

  Fly   103 HVQLPRSITEVELLDKINDLNEDPRVHGIIVQMPLDCDTPIDSHRITDAVSPEKDVDGLHTVNEG 167
            .:..|:::::.||||..:.||.||||.||:||:||  ...:|...|.:.::|||||||.|.:|.|
Mouse   134 LIIKPKNVSQEELLDITDQLNMDPRVSGILVQLPL--PDHVDERTICNGIAPEKDVDGFHIINIG 196

  Fly   168 RLAIGDLGGFLPCTPWGCLELIRRSGVEIAGARAVVLGRSKIVGTPAAELL--------KWANAT 224
            ||.: |....:|.|.....|:|:|:|:|..|...||.||||.||.|.|.||        ...:||
Mouse   197 RLCL-DQHSLIPATASAVWEIIKRAGIETFGKNVVVAGRSKNVGMPIAMLLHTDGEHERPGGDAT 260

  Fly   225 VTVCHSKT--RNLEEITRSADILVVGIGVAEMVKGSWIKPGAVVIDCGINVKPDASKASGSKLVG 287
            ||:.|..|  ..|:..|:.|||::|..|:..::....::.||.|||.|||...|..... :||||
Mouse   261 VTIAHRYTPREQLKAHTQLADIIIVAAGIPRLITADMVREGAAVIDVGINYIQDPVTGK-TKLVG 324

  Fly   288 DVDYAEALQVAGHLTPVPGGVGPMTVAMLMKNTVRSA 324
            |||:....:.|..:|||||||||||||||:|||:.:|
Mouse   325 DVDFEAVKKKASFITPVPGGVGPMTVAMLLKNTLLAA 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pugNP_001014614.1 FolD 39..330 CDD:223268 127/296 (43%)
THF_DHG_CYH 40..159 CDD:279147 49/118 (42%)
NAD_bind_m-THF_DH_Cyclohyd 154..324 CDD:133448 81/179 (45%)
FTHFS 350..968 CDD:279592
Mthfd2lXP_006535239.1 FolD 72..363 CDD:223268 127/295 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100216
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.