DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pug and Nmdmc

DIOPT Version :9

Sequence 1:NP_001014614.1 Gene:pug / 41279 FlyBaseID:FBgn0020385 Length:968 Species:Drosophila melanogaster
Sequence 2:NP_476929.1 Gene:Nmdmc / 47895 FlyBaseID:FBgn0010222 Length:309 Species:Drosophila melanogaster


Alignment Length:300 Identity:137/300 - (45%)
Similarity:182/300 - (60%) Gaps:17/300 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 AKIISGTAVAKSIREELRNEVTAMSKQLADF-VPGLRIVQVGGREDSNVYIRMKIKAATEIGIDA 101
            |:||.|.|:|:.:|.:|.:|:..|  :.|.: .|.|..|.||....|..|:..|:.|..|:||.:
  Fly     8 AQIIDGKAIAQEVRTQLAHELKGM--EAAGYPKPHLTAVIVGEDPASEKYVANKMVACREVGISS 70

  Fly   102 AHVQLPRSITEVELLDKINDLNEDPRVHGIIVQMPLDCDTPIDSHRITDAVSPEKDVDGLHTVNE 166
            ...:||.|.|:.|||..|.|||:||:|.||:||:|:  ...|:...|.:||..:|||||.:.||.
  Fly    71 ETKRLPASTTQEELLQLIADLNKDPQVTGILVQLPV--PEHINERTICNAVDVDKDVDGFNEVNI 133

  Fly   167 GRLAIGDLGGFLPCTPWGCLELIRRSGVEIAGARAVVLGRSKIVGTPAAELL----KWA----NA 223
            ||.|: |:...:|.||.|...|:....:|..|..|||:||||.|..|.|.||    |:|    :|
  Fly   134 GRTAL-DMEANIPATPLGVKRLLEHMKIETLGRNAVVVGRSKNVSLPMAILLHADGKYATKAMDA 197

  Fly   224 TVTVCHSKT--RNLEEITRSADILVVGIGVAEMVKGSWIKPGAVVIDCGINVKPDASKASGSKLV 286
            |||:||..|  :.|....|.|||:||.:|...::....:||||.|||.|||...|.|... .|||
  Fly   198 TVTICHRYTPPKELARHCRQADIIVVAVGKPGLITKDMVKPGACVIDVGINRIKDESTGQ-FKLV 261

  Fly   287 GDVDYAEALQVAGHLTPVPGGVGPMTVAMLMKNTVRSAAR 326
            ||||:.|..|||||:||||||||||||||||.||:::|.:
  Fly   262 GDVDFEEVRQVAGHITPVPGGVGPMTVAMLMHNTLKAARK 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pugNP_001014614.1 FolD 39..330 CDD:223268 136/298 (46%)
THF_DHG_CYH 40..159 CDD:279147 47/119 (39%)
NAD_bind_m-THF_DH_Cyclohyd 154..324 CDD:133448 90/179 (50%)
FTHFS 350..968 CDD:279592
NmdmcNP_476929.1 FolD 9..304 CDD:223268 136/298 (46%)
THF_DHG_CYH 10..126 CDD:279147 47/119 (39%)
THF_DHG_CYH_C 129..303 CDD:280955 86/174 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464702
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D41938at7147
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100216
Panther 1 1.100 - - P PTHR48099
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.