DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pug and MTHFD2L

DIOPT Version :9

Sequence 1:NP_001014614.1 Gene:pug / 41279 FlyBaseID:FBgn0020385 Length:968 Species:Drosophila melanogaster
Sequence 2:XP_016863707.1 Gene:MTHFD2L / 441024 HGNCID:31865 Length:456 Species:Homo sapiens


Alignment Length:294 Identity:112/294 - (38%)
Similarity:162/294 - (55%) Gaps:33/294 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GEWTAEPAIKMSG-----------------AKIISGTAVAKSIREELRNEVTAMSKQLADFVPGL 72
            |..|| |:::..|                 |.|||||.:||.|::|::..|.:. ..|.:..|.|
Human   125 GRSTA-PSVRAPGEPGSAFRGFRSSGVRHEAIIISGTEMAKHIQKEIQRGVESW-VSLGNRRPHL 187

  Fly    73 RIVQVGGREDSNVYIRMKIKAATEIGIDAAHVQLPRSITEVELLDKINDLNEDPRVHGIIVQMPL 137
            .|:.||....|:.|:|.||:||:.:||.:..:..|:.:::.||||..:.||.||||.||:||:||
Human   188 SIILVGDNPASHTYVRNKIRAASAVGICSELILKPKDVSQEELLDVTDQLNMDPRVSGILVQLPL 252

  Fly   138 DCDTPIDSHRITDAVSPEKDVDGLHTVNEGRLAIGDLGGFLPCTPWGCLELIRRSGVEIAGARAV 202
              ...:|...|.:.::|||||||.|.:|.|||.: |....:|.|.....|:|:|:|::..|...|
Human   253 --PDHVDERTICNGIAPEKDVDGFHIINIGRLCL-DQHSLIPATASAVWEIIKRTGIQTFGKNVV 314

  Fly   203 VLGRSKIVGTPAAELL--------KWANATVTVCHSKT--RNLEEITRSADILVVGIGVAEMVKG 257
            |.||||.||.|.|.||        ...:||||:.|..|  ..|:..|:.|||::|..|:.:::..
Human   315 VAGRSKNVGMPIAMLLHTDGEHERPGGDATVTIAHRYTPKEQLKIHTQLADIIIVAAGIPKLITS 379

  Fly   258 SWIKPGAVVIDCGINVKPDASKASGSKLVGDVDY 291
            ..:|.||.|||.|||...|..... :|||||||:
Human   380 DMVKEGAAVIDVGINYVHDPVTGK-TKLVGDVDF 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pugNP_001014614.1 FolD 39..330 CDD:223268 106/263 (40%)
THF_DHG_CYH 40..159 CDD:279147 48/118 (41%)
NAD_bind_m-THF_DH_Cyclohyd 154..324 CDD:133448 62/148 (42%)
FTHFS 350..968 CDD:279592
MTHFD2LXP_016863707.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100216
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.