DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pug and mthfd2l

DIOPT Version :9

Sequence 1:NP_001014614.1 Gene:pug / 41279 FlyBaseID:FBgn0020385 Length:968 Species:Drosophila melanogaster
Sequence 2:XP_005167203.1 Gene:mthfd2l / 327496 ZFINID:ZDB-GENE-030131-5707 Length:348 Species:Danio rerio


Alignment Length:303 Identity:117/303 - (38%)
Similarity:180/303 - (59%) Gaps:15/303 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 AIKMSGAKIISGTAVAKSIREELRNEVTAMSKQLADFVPGLRIVQVGGREDSNVYIRMKIKAATE 96
            ::|...|.::||..:|:.|.:|:::::..:..: .:..|.|.::.||....|:.|:|.|.:.|:.
Zfish    45 SLKRHVATVVSGAELARQIHKEVQSDIAKLVAE-GNRRPHLSVILVGDDHASHTYVRNKTRTASL 108

  Fly    97 IGIDAAHVQLPRSITEVELLDKINDLNEDPRVHGIIVQMPLDCDTPIDSHRITDAVSPEKDVDGL 161
            :|:.::.:..|.|:::.|:|:.|:..|.|..:.|::||:||  ...|:...|.:||:|||||||.
Zfish   109 LGMSSSTIFRPSSVSQEEMLELIDKFNRDRNISGLLVQLPL--PEHINERAICNAVAPEKDVDGF 171

  Fly   162 HTVNEGRLAIGDLGGFLPCTPWGCLELIRRSGVEIAGARAVVLGRSKIVGTPAAELL-------- 218
            |.||.|:|.: |....:|.|.....|:|||:|:|..|...:|:||||.||.|.|.||        
Zfish   172 HIVNIGKLCL-DQRCMIPATAAAVWEIIRRTGLETVGKNVLVVGRSKNVGMPIAMLLHSDRKHER 235

  Fly   219 KWANATVTVCHSKT--RNLEEITRSADILVVGIGVAEMVKGSWIKPGAVVIDCGINVKPDASKAS 281
            ...:|||.:.|..|  ..|:|:.|.|||::...||..::....:|.||.|||.|||...|.....
Zfish   236 SGGDATVIMAHRCTPLPRLKELARLADIVIAAAGVPHLITADMVKEGAAVIDVGINRMQDPVTGK 300

  Fly   282 GSKLVGDVDYAEALQVAGHLTPVPGGVGPMTVAMLMKNTVRSA 324
             |:||||||:....:.||.:|||||||||||:||:|||||.:|
Zfish   301 -SRLVGDVDFEAVKEKAGFITPVPGGVGPMTIAMVMKNTVTAA 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pugNP_001014614.1 FolD 39..330 CDD:223268 115/296 (39%)
THF_DHG_CYH 40..159 CDD:279147 35/118 (30%)
NAD_bind_m-THF_DH_Cyclohyd 154..324 CDD:133448 83/179 (46%)
FTHFS 350..968 CDD:279592
mthfd2lXP_005167203.1 PRK14190 50..343 CDD:184560 116/298 (39%)
THF_DHG_CYH 53..169 CDD:279147 35/118 (30%)
NAD_bind_m-THF_DH_Cyclohyd 164..343 CDD:133448 84/181 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592534
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100216
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.