DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pug and AgaP_AGAP004677

DIOPT Version :9

Sequence 1:NP_001014614.1 Gene:pug / 41279 FlyBaseID:FBgn0020385 Length:968 Species:Drosophila melanogaster
Sequence 2:XP_001687783.1 Gene:AgaP_AGAP004677 / 1275382 VectorBaseID:AGAP004677 Length:408 Species:Anopheles gambiae


Alignment Length:314 Identity:135/314 - (42%)
Similarity:187/314 - (59%) Gaps:21/314 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 AIKMSGAKIISGTAVAKSIREELRNEVTAMSKQLADFVPGLRIVQVGGREDSNVYIRMKIKAATE 96
            |.||  |::|.|..:|:.|:||||.::.....| ....|.|..:.:|....|..|:..|:|||.:
Mosquito   103 ASKM--AQLIDGKQIAREIQEELRKKIETWKAQ-GHRSPQLTAILIGDDPASTTYVNNKMKAAAD 164

  Fly    97 IGIDAAHVQLPRSITEVELLDKINDLNEDPRVHGIIVQMPLDCDTPIDSHRITDAVSPEKDVDGL 161
            :||::...:....|||.:||::|:.||.|..|.||::|:|:  ...||..::.:|||.:|||||.
Mosquito   165 VGIESKTERFGTEITEEQLLERIDQLNNDDAVDGILIQLPV--PNHIDERKVCNAVSCDKDVDGF 227

  Fly   162 HTVNEGRLAIGDLGGFLPCTPWGCLELIRRSGVEIAGARAVVLGRSKIVGTPAAELLK------- 219
            :..|.|||.: |:...:||||.|..|||:|:|:|..|..|||:||||.||.|.|.||.       
Mosquito   228 NERNIGRLCL-DMNTLIPCTPLGVQELIKRTGIETFGKNAVVVGRSKNVGMPIAMLLHADGRNDT 291

  Fly   220 -WANATVTVCHSKT--RNLEEITRSADILVVGIGVAEMVKGSWIKPGAVVIDCGINVKPDASKAS 281
             ..:.|||:||..|  :.|:...|:|||:|...||..::....||.||.:||.||....|.|...
Mosquito   292 CAMDCTVTICHRFTPPQELKRFCRTADIIVTATGVPGLITSDMIKEGAAIIDVGITRITDPSTGK 356

  Fly   282 GSKLVGDVDYAEALQVAGHLTPVPGGVGPMTVAMLMKNTVRSAARFLERLAKSQ 335
             .|||||||:.|..:.||.:|||||||||||||||||||:.:|    :.|||.:
Mosquito   357 -KKLVGDVDFEEVRKKAGLITPVPGGVGPMTVAMLMKNTIIAA----KNLAKKR 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pugNP_001014614.1 FolD 39..330 CDD:223268 128/300 (43%)
THF_DHG_CYH 40..159 CDD:279147 41/118 (35%)
NAD_bind_m-THF_DH_Cyclohyd 154..324 CDD:133448 88/179 (49%)
FTHFS 350..968 CDD:279592
AgaP_AGAP004677XP_001687783.1 FolD 108..404 CDD:223268 130/304 (43%)
THF_DHG_CYH 109..225 CDD:279147 41/118 (35%)
NAD_bind_m-THF_DH_Cyclohyd 221..399 CDD:133448 89/183 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.