DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pug and mthfd2l

DIOPT Version :9

Sequence 1:NP_001014614.1 Gene:pug / 41279 FlyBaseID:FBgn0020385 Length:968 Species:Drosophila melanogaster
Sequence 2:XP_002941814.2 Gene:mthfd2l / 100497864 XenbaseID:XB-GENE-6076442 Length:353 Species:Xenopus tropicalis


Alignment Length:305 Identity:134/305 - (43%)
Similarity:183/305 - (60%) Gaps:19/305 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 SGAKIISGTAVAKSIREELRNEV-TAMSKQLADFVPGLRIVQVGGREDSNVYIRMKIKAATEIGI 99
            |.|.|||||.:||.|:.|::.|| |.:|  |.:..|.|.::.||....|:.|::.||||||.:||
 Frog    55 SKATIISGTKLAKEIQREVQKEVETWLS--LGNRRPHLSVILVGDNPASHTYVKNKIKAATSVGI 117

  Fly   100 DAAHVQLPRSITEVELLDKINDLNEDPRVHGIIVQMPLDCDTPIDSHRITDAVSPEKDVDGLHTV 164
            .:..:..|..|:|.||||.|:.|:.|..|.|::||:||  ...|:...|.:||.|||||||.|.|
 Frog   118 SSEVILKPSKISEEELLDVISKLSNDSSVSGLLVQLPL--PEHINERAICNAVVPEKDVDGFHIV 180

  Fly   165 NEGRLAIGDLGGFLPCTPWGCLELIRRSGVEIAGARAVVLGRSKIVGTPAAELL--------KWA 221
            |.|||.: |....:|.|.....|:|:|:|:|..|...||.||||.||.|.:.||        ...
 Frog   181 NIGRLCL-DQWSIIPATAAAVWEIIKRTGIETFGKNVVVAGRSKNVGMPISMLLHTDGRHERPGG 244

  Fly   222 NATVTVCHSKTRN--LEEITRSADILVVGIGVAEMVKGSWIKPGAVVIDCGINVKPDASKASGSK 284
            :||||:.|..|..  |:..|:.|||::|..|:.:::....||.||.|||.|||...|  ..:|..
 Frog   245 DATVTITHRYTPKDLLKSHTQLADIIIVAAGIPKLITSDMIKEGATVIDVGINHIED--PVTGKT 307

  Fly   285 -LVGDVDYAEALQVAGHLTPVPGGVGPMTVAMLMKNTVRSAARFL 328
             :|||||:....:.||.:|||||||||||||||:|||:.:|.:.:
 Frog   308 IIVGDVDFEGVKEKAGFITPVPGGVGPMTVAMLLKNTLLAAKKLV 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pugNP_001014614.1 FolD 39..330 CDD:223268 132/302 (44%)
THF_DHG_CYH 40..159 CDD:279147 52/119 (44%)
NAD_bind_m-THF_DH_Cyclohyd 154..324 CDD:133448 83/180 (46%)
FTHFS 350..968 CDD:279592
mthfd2lXP_002941814.2 FolD 58..350 CDD:223268 132/298 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.