DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pug and mthfd2

DIOPT Version :9

Sequence 1:NP_001014614.1 Gene:pug / 41279 FlyBaseID:FBgn0020385 Length:968 Species:Drosophila melanogaster
Sequence 2:NP_001002181.1 Gene:mthfd2 / 100004977 ZFINID:ZDB-GENE-040704-20 Length:338 Species:Danio rerio


Alignment Length:307 Identity:134/307 - (43%)
Similarity:181/307 - (58%) Gaps:27/307 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 AKIISGTAVAKSIREELRNE----VTAMSKQLADFVPGLRIVQVGGREDSNVYIRMKIKAATEIG 98
            |.:|||..:|:.||.|.|::    |:|.:::     |.|.:|.||....|:.|:..|.:||.|:|
Zfish    30 AVVISGRKLARQIRNEARDDVEEWVSAGNRR-----PHLSVVLVGDNPASHSYVLNKTRAAAEVG 89

  Fly    99 IDAAHVQLPRSITEVELLDKINDLNEDPRVHGIIVQMPLDCDTPIDSHRITDAVSPEKDVDGLHT 163
            |.:..:..|.:|:|.||||.|..||.|.||.|::||:||  ...||..|:.:||.|.|||||.|.
Zfish    90 ISSETILKPSNISEEELLDLIVKLNSDHRVDGLLVQLPL--PDHIDERRVCNAVCPGKDVDGFHV 152

  Fly   164 VNEGRLAIGDLGGFLPCTPWGCLELIRRSGVEIAGARAVVLGRSKIVGTPAAELL--------KW 220
            ||.||:.: |....||.||||..|:|:|:|:|..|...:|.||||.||.|.|.||        ..
Zfish   153 VNVGRMCL-DQSTMLPATPWGVWEIIKRTGIETLGKNVLVAGRSKNVGMPIAMLLHTDGRHERPG 216

  Fly   221 ANATVTVCHSKT--RNLEEITRSADILVVGIGVAEMVKGSWIKPGAVVIDCGIN--VKPDASKAS 281
            .:||||:.|..|  ..|.:.|:.|||:|...|:..::....||.||.|||.|||  :.|...|  
Zfish   217 GDATVTISHRYTPKEQLRQHTKIADIIVAAAGIPNLITADMIKEGAAVIDVGINRILDPMTGK-- 279

  Fly   282 GSKLVGDVDYAEALQVAGHLTPVPGGVGPMTVAMLMKNTVRSAARFL 328
             ::||||||:....:.|..:|||||||||||||||||||:.:|...:
Zfish   280 -NRLVGDVDFEGVRKKASFITPVPGGVGPMTVAMLMKNTIIAAKNMI 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pugNP_001014614.1 FolD 39..330 CDD:223268 133/306 (43%)
THF_DHG_CYH 40..159 CDD:279147 49/122 (40%)
NAD_bind_m-THF_DH_Cyclohyd 154..324 CDD:133448 86/181 (48%)
FTHFS 350..968 CDD:279592
mthfd2NP_001002181.1 FolD 32..323 CDD:223268 133/301 (44%)
THF_DHG_CYH 32..148 CDD:279147 49/122 (40%)
NAD_bind_m-THF_DH_Cyclohyd 143..322 CDD:133448 86/182 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100216
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.