DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14688 and YJR154W

DIOPT Version :9

Sequence 1:NP_001097740.1 Gene:CG14688 / 41275 FlyBaseID:FBgn0037819 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_012688.1 Gene:YJR154W / 853619 SGDID:S000003915 Length:346 Species:Saccharomyces cerevisiae


Alignment Length:141 Identity:35/141 - (24%)
Similarity:56/141 - (39%) Gaps:24/141 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 TPHQDSWFLHTDPNSAVGFWLALEDCTLQNGCLQFIKGSHKSGVHRRYLRNPDKDASELMVYDRA 211
            |.||..........:.||..:|..|...:||..:.|.|||..|.|       |...:    :|:.
Yeast   176 TTHQACERFQYGTETMVGLGVAFTDMNKENGSTRMIVGSHLWGPH-------DSCGN----FDKR 229

  Fly   212 APIYPQSSFTPMQVSKGTCILIHGNVVHKSEPNRSQKSRHAYTFHV----IETENNVKYSEDNWL 272
            ...:       :.|:||..:|..|::.|.:..||:.:.|.|..|.:    ::.|.|:....|  |
Yeast   230 MEFH-------VNVAKGDAVLFLGSLYHAASANRTSQDRVAGYFFMTKSYLKPEENLHLGTD--L 285

  Fly   273 QAPKDKPFPVL 283
            :..|..|...|
Yeast   286 RVFKGLPLEAL 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14688NP_001097740.1 PhyH 11..252 CDD:283399 26/104 (25%)
YJR154WNP_012688.1 PhyH 37..338 CDD:227609 35/141 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5285
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.