DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14688 and zgc:174917

DIOPT Version :9

Sequence 1:NP_001097740.1 Gene:CG14688 / 41275 FlyBaseID:FBgn0037819 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001099060.1 Gene:zgc:174917 / 565650 ZFINID:ZDB-GENE-070928-42 Length:280 Species:Danio rerio


Alignment Length:286 Identity:60/286 - (20%)
Similarity:97/286 - (33%) Gaps:85/286 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ELNENGYIVIEDFLTAEEVDSLYQAGRALCLDAPQNNRKIFSTIKQEDAQGKELYFMESGDKVRY 72
            :..::||:.....|:.||:               |..|..|:.::::..:....|.:.:..| .|
Zfish    11 QYKQDGYLTALPILSPEEL---------------QQARNAFAELERKHGESYTAYSLHNIHK-EY 59

  Fly    73 FF-------------EKGAVGDEGQLLVDPMIALNKVGHALHVEHPAFNAI----------TFSN 114
            .:             ..|.:|.:..||....|....|| :.|.|....|.|          ..||
Zfish    60 DWVMALAKHPRLLEVVTGVLGPDVILLDSRFICKYPVG-SRHAEKQESNGIIQLSNTCNKAEDSN 123

  Fly   115 RVRE---ICWQLNYNKPAVCQSMYIYKNPGVGGEVTPHQDSWFLHTDPNSAVGFWLALEDCTLQN 176
            ...|   :.|                           |||..:...:....:..||||:|....|
Zfish   124 EKEEMPFVAW---------------------------HQDMKYWGFEGGPVLSVWLALDDSLEDN 161

  Fly   177 GCLQFIKGSHKSGV--HRRYLR-----NPDKDASELMVYDRAAPIYPQSSFTPMQVSKGTCILIH 234
            |.||.|.|||..|:  |.:..|     :.:::..|.:|....|.:.|        :..|...:..
Zfish   162 GALQVIPGSHHYGLLPHHQSKRAGNMLSVNQEIPEELVETEKALLCP--------LLAGQMSVHD 218

  Fly   235 GNVVHKSEPNRSQKSRHAYTFHVIET 260
            |.:||.|:||.|.:.|..|....:.|
Zfish   219 GLLVHASDPNTSNRRRCGYVIRYVPT 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14688NP_001097740.1 PhyH 11..252 CDD:283399 58/273 (21%)
zgc:174917NP_001099060.1 2OG-FeII_Oxy 12..234 CDD:304390 57/273 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5285
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.