DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14688 and phyh

DIOPT Version :9

Sequence 1:NP_001097740.1 Gene:CG14688 / 41275 FlyBaseID:FBgn0037819 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001017823.1 Gene:phyh / 550521 ZFINID:ZDB-GENE-050417-361 Length:335 Species:Danio rerio


Alignment Length:275 Identity:62/275 - (22%)
Similarity:101/275 - (36%) Gaps:85/275 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ENGYIVIEDFLTAEEVDSLYQAGRALC---LDAP-QNNRKIFSTIKQEDAQGKELY-----FMES 66
            |||:|:|.:.::.|::|........:|   :..| ....|..|..|.|..:|::..     :.|.
Zfish    60 ENGFILIRNLVSEEDIDRFRNEFERICKREVKVPGLTVMKDVSIAKSEFVEGEKAVTKLQDYQED 124

  Fly    67 GDKVRYFFEKGAVGDEGQLLVDPMIALNKVGHALHVEHPAFNAITFSNRVREICWQLNYNKPAV- 130
            .:..||             .|.|.|       ..:||                |    :..|.: 
Zfish   125 PELFRY-------------CVLPQI-------LKYVE----------------C----FTGPNIM 149

  Fly   131 -CQSMYIYKNPGVGGEVTPHQDSWFLHTDP----NSAVGFWLALEDCTLQNGCLQFIKGSHK--- 187
             ..:|.|.|.|..|.:.:.|.....||..|    :..|..|.|:|....:||||..:.|||:   
Zfish   150 AMHTMLINKPPDTGKKTSRHPMHQDLHYFPFRPADRIVCSWTAMEKVHRENGCLVVLPGSHRGSL 214

  Fly   188 ---------SGVHRRY--LRNPDKDASELMVYDRAAPIYPQSSFTPMQVSKGTCILIHGNVVHKS 241
                     .||::.|  :||          ||   |.:|:   ..:::.||..:..|..::|.|
Zfish   215 QEHDYPEWEGGVNKMYHGVRN----------YD---PNHPR---VHLEMEKGDTVFFHPLLIHGS 263

  Fly   242 EPNRSQKSRHAYTFH 256
            ..|::...|.|.:.|
Zfish   264 GMNQTNGFRKAISCH 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14688NP_001097740.1 PhyH 11..252 CDD:283399 60/269 (22%)
phyhNP_001017823.1 PhyH 58..274 CDD:283399 60/269 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5285
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.