DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14688 and PHYHD1

DIOPT Version :9

Sequence 1:NP_001097740.1 Gene:CG14688 / 41275 FlyBaseID:FBgn0037819 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_777593.2 Gene:PHYHD1 / 254295 HGNCID:23396 Length:297 Species:Homo sapiens


Alignment Length:174 Identity:65/174 - (37%)
Similarity:95/174 - (54%) Gaps:17/174 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LDELNENGYIVIEDFLTAEEVDSLYQ-AGRALC-LDAPQNNRKIFSTIKQED--AQGKELYFMES 66
            |.:..::|::|:|.||:|||..::.| .|..:. :|.|.:.|..|||.::|.  |||...||:.|
Human     9 LQKFQQDGFLVLEGFLSAEECVAMQQRIGEIVAEMDVPLHCRTEFSTQEEEQLRAQGSTDYFLSS 73

  Fly    67 GDKVRYFFEKGAVGDEGQLLVDPMIALNKVGHALHVEHPAFNAITFSNRVREICWQLNYNKPAVC 131
            |||:|:|||||...::|..||.|..::||:|||||...|.|.:||.|.:|:.:...|....|.|.
Human    74 GDKIRFFFEKGVFDEKGNFLVPPEKSINKIGHALHAHDPVFKSITHSFKVQTLARSLGLQMPVVV 138

  Fly   132 QSMYIYKNPGVGGEVTPHQDSWFLHTDPNSAVGFWLALEDCTLQ 175
            |||||:|:|             .:.|.|:.....|.....|..|
Human   139 QSMYIFKSP-------------LIRTPPSCTRSPWAGCWACGSQ 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14688NP_001097740.1 PhyH 11..252 CDD:283399 64/169 (38%)
PHYHD1NP_777593.2 2OG-FeII_Oxy 12..>147 CDD:304390 58/134 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144915
Domainoid 1 1.000 213 1.000 Domainoid score I2771
eggNOG 1 0.900 - - E1_COG5285
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H14939
Inparanoid 1 1.050 245 1.000 Inparanoid score I3297
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55076
OrthoDB 1 1.010 - - D1316775at2759
OrthoFinder 1 1.000 - - FOG0005799
OrthoInspector 1 1.000 - - oto89257
orthoMCL 1 0.900 - - OOG6_103405
Panther 1 1.100 - - LDO PTHR20883
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5439
SonicParanoid 1 1.000 - - X4187
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.