DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14688 and ZK550.5

DIOPT Version :9

Sequence 1:NP_001097740.1 Gene:CG14688 / 41275 FlyBaseID:FBgn0037819 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_503061.1 Gene:ZK550.5 / 191350 WormBaseID:WBGene00013999 Length:328 Species:Caenorhabditis elegans


Alignment Length:150 Identity:39/150 - (26%)
Similarity:56/150 - (37%) Gaps:31/150 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 SMYIYKNPGVGGEVT---PHQDSWFLHTDPNS-AVGFWLALEDCTLQNGCLQFIKGSH------- 186
            :|.|.|.|..|...:   .|||..:....|.. .|..|.|:|....||||||.:.|:.       
 Worm   139 TMLINKPPDTGALTSRHPMHQDLIYFPWRPEELTVCAWTAMEKINKQNGCLQVVPGTQARGLQVH 203

  Fly   187 -----KSGVHRRYLRNPDKDASELMVYDRAAPIYPQSSFTPMQVSKGTCILIHGNVVHKSEPNRS 246
                 :.||:..|....|.|.|....|              :::..|..:..|..:.|.|..|||
 Worm   204 GYPEWEGGVNMAYYAIKDYDMSLPREY--------------VEMEAGDTVFFHPCLFHGSGANRS 254

  Fly   247 QKSRHAYTFHVIETENNVKY 266
            :..|.|.:.|....: :.||
 Worm   255 EGFRKAISCHYANYD-HTKY 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14688NP_001097740.1 PhyH 11..252 CDD:283399 35/134 (26%)
ZK550.5NP_503061.1 PhyH 40..260 CDD:283399 35/134 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5285
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.