DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14688 and ZK550.6

DIOPT Version :9

Sequence 1:NP_001097740.1 Gene:CG14688 / 41275 FlyBaseID:FBgn0037819 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_503062.1 Gene:ZK550.6 / 178503 WormBaseID:WBGene00014000 Length:312 Species:Caenorhabditis elegans


Alignment Length:282 Identity:61/282 - (21%)
Similarity:110/282 - (39%) Gaps:76/282 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ENGYIVIEDFLTAEEVDSLYQAGRALC---LDAPQNN--RKIFSTIKQEDAQGKELYFMESGDKV 70
            :|||::|.:.:...|::...|..:.:|   :.||:|.  .|..|..|.|...|::..     .|:
 Worm    26 KNGYLLIRNCVPQYELNRFRQRFQDICEKKVKAPENMTVMKDISIAKSEFKDGEKAI-----TKI 85

  Fly    71 RYFFEKGAVGDEGQLLVDPMIALNKVGHALHVEHPAFNAITFSNRVREICWQLNYNKPAVCQSMY 135
            :.|.:            ||::          .|:..:..:.  :.|:::......|..|: .:|.
 Worm    86 QDFAD------------DPVL----------FEYCKYPGVV--DVVKDLIGNPKSNLMAM-HTML 125

  Fly   136 IYKNPGVGGEVTP----HQDSWFLHTDPNSAV-GFWLALEDCTLQNGCLQFIKGSHK-------- 187
            |.|.|. .|::|.    |||..:....|...: ..|.|:|..|..||||..:.|:||        
 Worm   126 INKPPD-NGKLTSRHPMHQDLQYFPFRPADFICCAWTAMEKITRANGCLVVVPGTHKGVLLPHEY 189

  Fly   188 ----SGVHRRYLRNPDKDASELMVYDRAAPIYPQSSFTPMQVSKGTCILIHGNVVHKSEPNRSQK 248
                .||::.|....|.|.|...::              :::..|..:..|..::|.|..||::.
 Worm   190 PKWEGGVNKAYHGIQDYDTSTPRIH--------------VEMEPGDTVFFHPILIHGSGANRTEG 240

  Fly   249 SRHAYTFHVIETENNVKYSEDN 270
            .|.|.:.|         |:.|:
 Worm   241 FRKAISCH---------YANDD 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14688NP_001097740.1 PhyH 11..252 CDD:283399 57/262 (22%)
ZK550.6NP_503062.1 PhyH 24..244 CDD:283399 57/262 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5285
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.