DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14688 and Phyh

DIOPT Version :9

Sequence 1:NP_001097740.1 Gene:CG14688 / 41275 FlyBaseID:FBgn0037819 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_034856.1 Gene:Phyh / 16922 MGIID:891978 Length:338 Species:Mus musculus


Alignment Length:265 Identity:57/265 - (21%)
Similarity:97/265 - (36%) Gaps:65/265 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ENGYIVIEDFLTAEEVDSLYQAGRALCLDAPQNNRKIFSTIKQEDAQGKELYFMESGDKVRYFFE 75
            |||::||::.::.:::               |..|..|..|.:|:.:...:..|..         
Mouse    63 ENGFLVIKNLVSDDDI---------------QRFRAEFERICREEVKPPGIVIMRD--------- 103

  Fly    76 KGAVGDEGQLLVDPMIALNKVGHALHVEHPAFNAITFSNRVREI-CWQLNYNKPAV--CQSMYIY 137
             .|:..:..:..|.|:  :|: .....:...|........::.: |    :..|.:  ...|.|.
Mouse   104 -VALAKQDYMPSDRMV--SKI-QDFQEDEELFRYCLLPEILKYVEC----FTGPNIMALHGMLIN 160

  Fly   138 KNPGVGGEVTPHQDSWFLHTDP----NSAVGFWLALEDCTLQNGCLQFIKGSHK----------- 187
            |.|.||.:.:.|.....||..|    |..|..|.|:|.....||||..:.|:||           
Mouse   161 KPPDVGKKTSRHPLHQDLHYFPFRPSNLIVCAWTAMEHIDRNNGCLVVLPGTHKGTLKPHDYPKW 225

  Fly   188 -SGVHRRYLRNPDKDASELMVYDRAAPIYPQSSFTPMQVSKGTCILIHGNVVHKSEPNRSQKSRH 251
             .||::.|....|.|              |.|....:.:.||..:..|..::|.|..|::|..|.
Mouse   226 EGGVNKMYHGIQDYD--------------PNSPRVHLVMEKGDTVFFHPLLIHGSGRNKTQGFRK 276

  Fly   252 AYTFH 256
            |.:.|
Mouse   277 AISCH 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14688NP_001097740.1 PhyH 11..252 CDD:283399 55/259 (21%)
PhyhNP_034856.1 PhyH 61..277 CDD:283399 55/259 (21%)
Alpha-ketoglutarate binding. /evidence=ECO:0000250|UniProtKB:O14832 175..177 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5285
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.