DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6465 and DUG2

DIOPT Version :9

Sequence 1:NP_650004.1 Gene:CG6465 / 41274 FlyBaseID:FBgn0037818 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_009840.3 Gene:DUG2 / 852584 SGDID:S000000485 Length:878 Species:Saccharomyces cerevisiae


Alignment Length:408 Identity:76/408 - (18%)
Similarity:127/408 - (31%) Gaps:114/408 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TSKW--------ESDEEIQYFREYLRIPSVHPDPDYAPCVEFLRRQANLMDLPMKVYYPANEQ-- 57
            |:.|        .::|.:...||.:...:|....|....:...|....|..|.:| :...|.|  
Yeast   421 TNLWAAYQSASLNNEEMLNTLRELISFQTVSQSKDTTNTLSLRRCAIYLQQLFLK-FGATNSQLF 484

  Fly    58 ------NPVVVLTWKGLNPELPS--------ILLNSHMDVVP---VFPENWTHPPFGADIDEEGR 105
                  ||||...::| |.::..        ||...|.||:.   .|  ||...||.... |.|.
Yeast   485 PLPDGGNPVVFAYFQG-NGKVSQVKGAKKKRILWYGHYDVISSGNTF--NWNTDPFTLTC-ENGY 545

  Fly   106 IFARGTQDMKSVGMQHLAAVRALKRSGAKFKRTIHISFVADEEMGGRYGMRPFVPTEDFRALNVG 170
            :..||..|.|...:..:.:|..|.:.|......:.: ....||:|.....:......|....::.
Yeast   546 LKGRGVSDNKGPLVSAIHSVAYLFQQGELVNDVVFL-VEGSEEIGSASLKQVCEKYHDIIGKDID 609

  Fly   171 FAMDEGLASPDEQLP-LFYAERAVWRVYFNI--------SGTAG--------------------H 206
            :.:.......|::.| |.|..|.|......:        ||..|                    .
Yeast   610 WILLSNSTWVDQEHPCLNYGLRGVINAQIKVWSDKPDGHSGLNGGVYDEPMVNLVKIVSKLQNEQ 674

  Fly   207 GSLLLPNTAGEKLNYIVGKMMEFRRSQVQRLQNNPELV-IGDVTTI-----NLT---------KL 256
            ..:::||        ....:.:....:.||.|...||. |.:.||:     |.|         |.
Yeast   675 NEIMIPN--------FYSPLKDLTEEEYQRFQKITELANIDENTTVQDLITNWTKPSLSMTTVKF 731

  Fly   257 GGGVQSNVVPPLLMVCFDCRLALDVDFEEFEANLHKWCADVGGGIEITYEQKQPKVPPTAIDGSN 321
            .|.....|:|..:.:....||..:...|:.:.:|..:..:                         
Yeast   732 SGPGNITVIPKSVTMGISIRLVPEQSVEQVKRDLKAYLEE------------------------- 771

  Fly   322 PFWLAFKKATDEMHISIK 339
                :||:...:.|:.||
Yeast   772 ----SFKQLKSQNHLEIK 785

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6465NP_650004.1 Ac-peptdase-euk 1..401 CDD:273850 76/408 (19%)
M20_AcylaseI_like 8..399 CDD:193524 74/395 (19%)
DUG2NP_009840.3 WD40 19..336 CDD:421866
WD40 repeat 23..60 CDD:293791
WD40 repeat 74..121 CDD:293791
WD40 repeat 126..158 CDD:293791
WD40 repeat 166..213 CDD:293791
WD40 repeat 226..280 CDD:293791
WD40 repeat 288..324 CDD:293791
WD40 repeat 343..372 CDD:293791
M20_dipept_like_DUG2_type 437..878 CDD:349926 73/392 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0624
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.