DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6465 and AT4G17830

DIOPT Version :9

Sequence 1:NP_650004.1 Gene:CG6465 / 41274 FlyBaseID:FBgn0037818 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_001190758.1 Gene:AT4G17830 / 827506 AraportID:AT4G17830 Length:445 Species:Arabidopsis thaliana


Alignment Length:411 Identity:94/411 - (22%)
Similarity:152/411 - (36%) Gaps:108/411 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 VYYPANEQNPVVVLTWKGLNPELPSILLNSHMDVVPVFPENWTHPPFGADIDEEGRIFARGTQDM 114
            |.||.:.  |..:|::.|:           |||||...|::|...||...||.: ::..|||.|.
plant    84 VEYPGSV--PGKILSFVGM-----------HMDVVTANPDDWEFDPFSLSIDGD-KLRGRGTTDC 134

  Fly   115 KSVGMQHLAAVRAL-KRSG-AK--FKRTIHISFVADEEMGGRYGMRPFVPTEDFRALNVGFAMDE 175
                :.|:|.|..| |:.| ||  .|.|:...|:|.||...       :|......|.....:|:
plant   135 ----LGHVALVTELMKKLGQAKPALKSTVVAVFIASEENSS-------IPGVGVDMLVKDKLLDK 188

  Fly   176 GLASPDEQLPLFYAERA------------VWRVYFNISGTAGHGSLLLPNTAGEKLNYIVGKMME 228
            ..:.|.....|::.:.|            .|::.|.       |.|.....|.:.:|.:...|..
plant   189 LKSGPLLVSILYWIDTADKQPCVGTGGMIPWKLQFT-------GKLFHSGLAHKAINAMELAMEG 246

  Fly   229 FRRSQVQRLQNNP----ELVIGDVT--TINLTKL---GGGVQSNVVPPLLMVCFDCRLALDVDFE 284
            .:..|.:..::.|    |.|.|..|  |:..|:.   .||:  |.:|....|..|.||....|.:
plant   247 LKEIQARFYRDFPPHPQEEVYGFATPSTMKPTQWCYPAGGI--NQIPGECTVSGDVRLTPFYDVK 309

  Fly   285 EFEANLHKWCADVGGGIE-----------------------ITYEQKQPKVPPTAIDGSNPFWLA 326
            |....|.::..|:.|.||                       :::::....|   |.:..:|.:..
plant   310 EVITKLQEYVDDINGNIERLETRGPVSKYVLPDENLRGRLTLSFDEASAGV---ACNLDSPGFHV 371

  Fly   327 FKKATDEMHISIKPQIFTG-----------GTDSRYIRAVGIPALGFSPMNNTPVLLHDHDEFIQ 380
            ..|||:|:...:||...||           |.|        :...|:..|    ...|..:|:..
plant   372 LCKATEEVVGHVKPYSITGTLPLIRDLQDEGFD--------VQTSGYGLM----ATYHAKNEYCL 424

  Fly   381 ADIYLRGVQIFQKIISNIANV 401
            .....:|..:|.:|||.:..|
plant   425 LTDMCQGFDVFIRIISQLEQV 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6465NP_650004.1 Ac-peptdase-euk 1..401 CDD:273850 93/409 (23%)
M20_AcylaseI_like 8..399 CDD:193524 93/407 (23%)
AT4G17830NP_001190758.1 M20_ArgE-related 15..442 CDD:193560 93/406 (23%)
Peptidase_M20 101..441 CDD:279835 86/375 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0624
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1432382at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.