DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6465 and Cndp1

DIOPT Version :9

Sequence 1:NP_650004.1 Gene:CG6465 / 41274 FlyBaseID:FBgn0037818 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_001007688.1 Gene:Cndp1 / 307212 RGDID:1359493 Length:492 Species:Rattus norvegicus


Alignment Length:480 Identity:97/480 - (20%)
Similarity:177/480 - (36%) Gaps:127/480 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DEEIQYFREYLRI--PSVHPDPDYAPCVEFLRRQA----NLMDLPMKV--------YYPANEQ-- 57
            ||.:|..:|::.|  .||.|.|....  |..|..|    .|.:|..:|        ..|..:.  
  Rat    22 DEFVQTLKEWVAIESDSVQPMPRLRQ--ELFRMMALAADKLRNLGARVDSVDLGSQQMPDGQSLP 84

  Fly    58 NPVVVLTWKGLNPELPSILLNSHMDVVPVFPEN-WTHPPFG-ADIDEEGRIFARGTQDMKSVGMQ 120
            .|.::|...|.:|:.||:....|:||.|...|: |...|:. .::|  |:::.||..|.|...:.
  Rat    85 TPPIILAELGNDPKKPSVCFYGHLDVQPAQKEDGWLTDPYTLTEVD--GKLYGRGATDNKGPVLA 147

  Fly   121 HLAAV---RALKRSGAKFKRTIHISFVAD-EEMGGRYGMRPFVPTED---FRALNVGFAMDEGLA 178
            .:.||   |||::.     ..:::.|:.: .|..|...:...|..|.   |..::. ..:.:.|.
  Rat   148 WINAVSTFRALQQD-----LPVNVKFILEGMEEAGSVALEELVKREKDNFFSGVDY-IVISDNLW 206

  Fly   179 SPDEQLPLFYAERAVWRVYFNI----------SGTAG--------------------HGSLLLPN 213
            ...::..|....|.  ..||.:          |||.|                    .|.:|:|.
  Rat   207 LSQKKPALTCGTRG--NCYFTVEVKCRDQDFHSGTFGGILNEPMADLVALLGSLVDSSGHILVPG 269

  Fly   214 --------TAGEKLNY--IVGKMMEFRR-SQVQR--LQNNPELV--IGDVTTINLTKLGGGVQ-- 261
                    |..||..|  |...:.|::: |:|:|  .....||:  :....::::..:.|...  
  Rat   270 IYDQMAPITEEEKTMYENIDLDLEEYQKSSRVERFLFDTKEELLTHLWRYPSLSIHGIEGAFDEP 334

  Fly   262 --SNVVPPLLMVCFDCRLA--LDVDFEEFEANLHKWCADVGGGIEITYEQKQP--KVPPTAIDGS 320
              ..|:|..::..|..||.  :.....|.:...|         :|..:.::..  |:..:.:.|.
  Rat   335 GTKTVIPGRVLGKFSIRLVPHMTPSVVETQVTQH---------LEAVFSKRNSFNKMAVSMVLGL 390

  Fly   321 NPF--------WLAFKKATDEMHISIKPQIFTGGTDSRYIRAVGIP-ALGFSPMNNTPVLL---- 372
            .|:        :||.::|...: ..:.|.:...|:.        || |..|..:....|::    
  Rat   391 QPWTANINGTQYLAARRAIQTV-FGVDPDMIQDGST--------IPIAKIFQDITQKSVMMLPLG 446

  Fly   373 ------HDHDEFIQADIYLRGVQIF 391
                  |..:|.|....|::|.::|
  Rat   447 AVDDGEHSQNEKINRWNYIQGSKLF 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6465NP_650004.1 Ac-peptdase-euk 1..401 CDD:273850 97/480 (20%)
M20_AcylaseI_like 8..399 CDD:193524 97/480 (20%)
Cndp1NP_001007688.1 M20_dipept_like_CNDP 13..481 CDD:193551 97/480 (20%)
PRK08201 16..481 CDD:169276 97/480 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0624
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.