DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6465 and ABHD14A

DIOPT Version :9

Sequence 1:NP_650004.1 Gene:CG6465 / 41274 FlyBaseID:FBgn0037818 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_056222.2 Gene:ABHD14A / 25864 HGNCID:24538 Length:271 Species:Homo sapiens


Alignment Length:47 Identity:14/47 - (29%)
Similarity:21/47 - (44%) Gaps:5/47 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 QNPVVVLTWKGLNPELPSILLNSHM--DVVPVFP---ENWTHPPFGA 98
            ||.|:|......:..||.::...|.  ..||:.|   :|:|...|.|
Human   163 QNAVLVSPSLSGHYALPFLMRGHHQLHGFVPIAPTSTQNYTQEQFWA 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6465NP_650004.1 Ac-peptdase-euk 1..401 CDD:273850 14/47 (30%)
M20_AcylaseI_like 8..399 CDD:193524 14/47 (30%)
ABHD14ANP_056222.2 MhpC 74..270 CDD:223669 14/47 (30%)
Abhydrolase_5 97..250 CDD:289465 14/47 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.854522 Normalized mean entropy S2324
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.