Sequence 1: | NP_476576.1 | Gene: | hth / 41273 | FlyBaseID: | FBgn0001235 | Length: | 487 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_631960.1 | Gene: | TGIF2LY / 90655 | HGNCID: | 18569 | Length: | 185 | Species: | Homo sapiens |
Alignment Length: | 205 | Identity: | 48/205 - (23%) |
---|---|---|---|
Similarity: | 76/205 - (37%) | Gaps: | 72/205 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 258 DARSPGAGSTPGPLSQQPPALDTSDPDGKFLSSLNPSELTYDGRWCRREWSSPADARNADASRRL 322
Fly 323 YSSVFLGSPDNFGTSASGDASNASIGSGEGTGEEDDDASGKKNQKKRGIFPKVATNILRAWLFQH 387
Fly 388 LTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVYTPHPGPSGYGHDAMGY 452
Fly 453 MMDSQAHMMH 462 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
hth | NP_476576.1 | Meis_PKNOX_N | 127..211 | CDD:406806 | |
Homeobox_KN | 383..422 | CDD:399131 | 18/38 (47%) | ||
TGIF2LY | NP_631960.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..58 | 17/114 (15%) | |
Homeobox_KN | 68..107 | CDD:310480 | 18/38 (47%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 166..185 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165152641 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |