DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hth and TGIF2LX

DIOPT Version :9

Sequence 1:NP_476576.1 Gene:hth / 41273 FlyBaseID:FBgn0001235 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_620410.3 Gene:TGIF2LX / 90316 HGNCID:18570 Length:241 Species:Homo sapiens


Alignment Length:232 Identity:54/232 - (23%)
Similarity:82/232 - (35%) Gaps:83/232 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 DARSPGAGSTPGPLSQQPPALDTSDPDGKFLSSLNPSELTYDGRWCRREWSSPADARNADASRRL 322
            :|.:.|...|..|:.:..||...|......:.|.|                      |||..|  
Human     2 EAAADGPAETQSPVEKDSPAKTQSPAQDTSIMSRN----------------------NADTGR-- 42

  Fly   323 YSSVFLGSPDNFGTSASGDASNASIGSGEGTGEEDDDASGKKNQKKRGIFPKVATNILRAWLFQH 387
                .|..|::                               .:|::|..|..:..|||.|:::|
Human    43 ----VLALPEH-------------------------------KKKRKGNLPAESVKILRDWMYKH 72

  Fly   388 LTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVYTPHPGPSGYGHDAMGY 452
            ....||||::|:.|::.|.|::||::||||||||||:..|:.|..             ....:|:
Human    73 RFKAYPSEEEKQMLSEKTNLSLLQISNWFINARRRILPDMLQQRR-------------NDPIIGH 124

  Fly   453 MMDSQAHMMH-----------RPPGDPGFHQGYPHYP 478
            .....||..|           ..|..|...|..|.:|
Human   125 KTGKDAHATHLQSTEASVPAKSGPSGPDNVQSLPLWP 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hthNP_476576.1 Meis_PKNOX_N 127..211 CDD:406806
Homeobox_KN 383..422 CDD:399131 19/38 (50%)
TGIF2LXNP_620410.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..58 17/114 (15%)
Homeobox_KN 68..107 CDD:283551 19/38 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 126..210 8/36 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152640
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.