DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hth and TOS8

DIOPT Version :9

Sequence 1:NP_476576.1 Gene:hth / 41273 FlyBaseID:FBgn0001235 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_011419.1 Gene:TOS8 / 852783 SGDID:S000003064 Length:276 Species:Saccharomyces cerevisiae


Alignment Length:91 Identity:40/91 - (43%)
Similarity:54/91 - (59%) Gaps:8/91 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   335 GTSASGDASNASI-GSGEGTGEEDDDASGKKNQK--KRGIFPKVATNILRAWLFQHLTHPYPSED 396
            |...||:.|..|: ||..|.     .|..||::.  ||...||...:||..||.:|:.:|||:..
Yeast   166 GKMLSGNISTNSVRGSNNGY-----SAKEKKHKAHGKRSNLPKATVSILNKWLHEHVNNPYPTVQ 225

  Fly   397 QKKQLAQDTGLTILQVNNWFINARRR 422
            :|::|...||||.||::|||||||||
Yeast   226 EKRELLAKTGLTKLQISNWFINARRR 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hthNP_476576.1 Meis_PKNOX_N 127..211 CDD:406806
Homeobox_KN 383..422 CDD:399131 21/38 (55%)
TOS8NP_011419.1 Homeobox_KN 212..251 CDD:399131 21/38 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I2592
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000410
OrthoInspector 1 1.000 - - mtm9183
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11850
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2315
SonicParanoid 1 1.000 - - X78
TreeFam 00.000 Not matched by this tool.
77.030

Return to query results.
Submit another query.