powered by:
Protein Alignment hth and HMLALPHA2
DIOPT Version :9
Sequence 1: | NP_476576.1 |
Gene: | hth / 41273 |
FlyBaseID: | FBgn0001235 |
Length: | 487 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_009866.1 |
Gene: | HMLALPHA2 / 850292 |
SGDID: | S000000572 |
Length: | 210 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 65 |
Identity: | 20/65 - (30%) |
Similarity: | 33/65 - (50%) |
Gaps: | 1/65 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 359 DASGKKNQKKRG-IFPKVATNILRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRR 422
|...|..:..|| .|.|....||.:|..:::.:||......:.|.::|.|:.:|:.||..|.||:
Yeast 122 DMINKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRK 186
Fly 423 422
Yeast 187 186
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG0773 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.