DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hth and BLH11

DIOPT Version :9

Sequence 1:NP_476576.1 Gene:hth / 41273 FlyBaseID:FBgn0001235 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_177676.2 Gene:BLH11 / 843879 AraportID:AT1G75430 Length:290 Species:Arabidopsis thaliana


Alignment Length:65 Identity:37/65 - (56%)
Similarity:48/65 - (73%) Gaps:1/65 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   369 RGIFPKVATNILRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNR 433
            ||: |:.:..|||||||||..||||:|.:|..||..|||:..||:|||||||.|:.:|||::..|
plant   207 RGL-PETSVAILRAWLFQHFLHPYPNEAEKLVLASQTGLSKNQVSNWFINARVRLWKPMIEEMYR 270

  Fly   434  433
            plant   271  270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hthNP_476576.1 Meis_PKNOX_N 127..211 CDD:406806
Homeobox_KN 383..422 CDD:399131 25/38 (66%)
BLH11NP_177676.2 POX 16..148 CDD:400075
Homeobox_KN 220..259 CDD:399131 25/38 (66%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 60 1.000 Domainoid score I3843
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2647
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11850
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X78
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.