powered by:
Protein Alignment hth and BLH11
DIOPT Version :9
Sequence 1: | NP_476576.1 |
Gene: | hth / 41273 |
FlyBaseID: | FBgn0001235 |
Length: | 487 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_177676.2 |
Gene: | BLH11 / 843879 |
AraportID: | AT1G75430 |
Length: | 290 |
Species: | Arabidopsis thaliana |
Alignment Length: | 65 |
Identity: | 37/65 - (56%) |
Similarity: | 48/65 - (73%) |
Gaps: | 1/65 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 369 RGIFPKVATNILRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNR 433
||: |:.:..|||||||||..||||:|.:|..||..|||:..||:|||||||.|:.:|||::..|
plant 207 RGL-PETSVAILRAWLFQHFLHPYPNEAEKLVLASQTGLSKNQVSNWFINARVRLWKPMIEEMYR 270
Fly 434 433
plant 271 270
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
1 |
1.000 |
60 |
1.000 |
Domainoid score |
I3843 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG0773 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
1 |
1.000 |
- |
- |
|
otm2647 |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR11850 |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
1 |
1.000 |
- |
- |
|
X78 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
6 | 5.910 |
|
Return to query results.
Submit another query.