DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hth and BLH11

DIOPT Version :10

Sequence 1:NP_476576.1 Gene:hth / 41273 FlyBaseID:FBgn0001235 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_177676.2 Gene:BLH11 / 843879 AraportID:AT1G75430 Length:290 Species:Arabidopsis thaliana


Alignment Length:65 Identity:37/65 - (56%)
Similarity:48/65 - (73%) Gaps:1/65 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   369 RGIFPKVATNILRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNR 433
            ||: |:.:..|||||||||..||||:|.:|..||..|||:..||:|||||||.|:.:|||::..|
plant   207 RGL-PETSVAILRAWLFQHFLHPYPNEAEKLVLASQTGLSKNQVSNWFINARVRLWKPMIEEMYR 270

  Fly   434  433
            plant   271  270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hthNP_476576.1 Meis_PKNOX_N 127..211 CDD:465140
Homeobox_KN 384..422 CDD:428673 24/37 (65%)
BLH11NP_177676.2 POX 16..148 CDD:429514
Homeobox_KN 221..259 CDD:428673 24/37 (65%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.