DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment hth and BLH3

DIOPT Version :9

Sequence 1:	NP_476576.1	Gene:	hth / 41273	FlyBaseID:	FBgn0001235	Length:	487	Species:	Drosophila melanogaster
Sequence 2:	NP_001077827.1	Gene:	BLH3 / 843877	AraportID:	AT1G75410	Length:	524	Species:	Arabidopsis thaliana

Alignment Length:	63	Identity:	34/63 - (53%)
Similarity:	48/63 - (76%)	Gaps:	1/63 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly   368 KRGIFPKVATNILRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQ 430
            :||: |:.:.:|||||||:|..||||.|.:|..|::.|||:..||.|||||||.|:.:|||::
plant   350 QRGL-PENSVSILRAWLFEHFLHPYPKESEKIMLSKQTGLSKNQVANWFINARVRLWKPMIEE 411

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
hth	NP_476576.1	Meis_PKNOX_N	127..211	CDD:406806
hth	NP_476576.1	Homeobox_KN	383..422	CDD:399131	23/38 (61%)
BLH3	NP_001077827.1	POX	168..296	CDD:400075
BLH3	NP_001077827.1	Homeobox_KN	364..403	CDD:399131	23/38 (61%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	1	1.000	60	1.000	Domainoid score	I3843
eggNOG	1	0.900	-	-		E1_KOG0773
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	1	1.000	-	-		otm2647
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR11850
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	1	1.000	-	-		X78
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	5	5.000