DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hth and KNAT2

DIOPT Version :9

Sequence 1:NP_476576.1 Gene:hth / 41273 FlyBaseID:FBgn0001235 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_001320784.1 Gene:KNAT2 / 843388 AraportID:AT1G70510 Length:314 Species:Arabidopsis thaliana


Alignment Length:389 Identity:78/389 - (20%)
Similarity:118/389 - (30%) Gaps:166/389 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 IPEVHKRD--------KDAIYEHPLFPLLALIFEKCELATCTPREPGVQGGDVCSSESFNEDIAM 142
            :|.:.|.:        |..|..|||:|.|...:..|:       :.|......|..|....:..:
plant    54 LPRIRKAEDNFSLSVIKSKIASHPLYPRLLQTYIDCQ-------KVGAPMEIACILEEIQRENHV 111

  Fly   143 FSKQIRSQKPYYTADPEVDSLMVQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVID 207
            :.:.: :....:.||||:|..||...:.             .||       ..:|.|..:....|
plant   112 YKRDV-APLSCFGADPELDEFMVSHFET-------------YCD-------ILVKYKTDLARPFD 155

  Fly   208 ERDT-------------TKPPELGSANGEGRSNADSTSHTDGASTPDVRPPSSSLSYGGAMNDDA 259
            |..|             |.|....:.:.:|..::|.....|                     ||.
plant   156 EATTFINKIEMQLQNLCTGPASATALSDDGAVSSDEELRED---------------------DDI 199

  Fly   260 RSPGAGSTPGPLSQQPPALDTSDPD---------GKFLSSLNPSELTYDGRWCRREWSSPADARN 315
            .:..        |||    .::|.|         |..:|||            :.|:|       
plant   200 AADD--------SQQ----RSNDRDLKDQLLRKFGSHISSL------------KLEFS------- 233

  Fly   316 ADASRRLYSSVFLGSPDNFGTSASGDASNASIGSGEGTGEEDDDASGKKNQKKRGIFPKVATNIL 380
                                                             .:||:|..|:.|...|
plant   234 -------------------------------------------------KKKKKGKLPREARQAL 249

  Fly   381 RAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRRIVQP-------MIDQSNRAVYT 437
            ..|...|...|||:|..|..||::|||...|:||||||.|:|..:|       |:|.||...:|
plant   250 LDWWNVHNKWPYPTEGDKISLAEETGLDQKQINNWFINQRKRHWKPSENMPFDMMDDSNETFFT 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hthNP_476576.1 Meis_PKNOX_N 127..211 CDD:406806 15/83 (18%)
Homeobox_KN 383..422 CDD:399131 20/38 (53%)
KNAT2NP_001320784.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11850
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X78
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.