DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hth and BEL10

DIOPT Version :9

Sequence 1:NP_476576.1 Gene:hth / 41273 FlyBaseID:FBgn0001235 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_001154352.1 Gene:BEL10 / 838558 AraportID:AT1G19700 Length:538 Species:Arabidopsis thaliana


Alignment Length:108 Identity:41/108 - (37%)
Similarity:60/108 - (55%) Gaps:28/108 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   350 GEGTGEEDDDASGKK-------NQK--------------------KRGIFPKVATNILRAWLFQH 387
            ||..||..|:..|::       :|:                    :||: |:.:.::||||||:|
plant   310 GEKGGESLDEQQGERIPRLRYLDQRLRQQRALHQQLGMVRPAWRPQRGL-PENSVSVLRAWLFEH 373

  Fly   388 LTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQ 430
            ..||||.|.:|..||:.|||:..||.|||||||.|:.:|||::
plant   374 FLHPYPKESEKIMLAKQTGLSKNQVANWFINARVRLWKPMIEE 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hthNP_476576.1 Meis_PKNOX_N 127..211 CDD:406806
Homeobox_KN 383..422 CDD:399131 24/38 (63%)
BEL10NP_001154352.1 POX 166..298 CDD:369404
Homeobox_KN 369..408 CDD:368670 24/38 (63%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 60 1.000 Domainoid score I3843
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2647
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11850
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X78
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.000

Return to query results.
Submit another query.