DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hth and KNAT3

DIOPT Version :9

Sequence 1:NP_476576.1 Gene:hth / 41273 FlyBaseID:FBgn0001235 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_197904.1 Gene:KNAT3 / 832593 AraportID:AT5G25220 Length:431 Species:Arabidopsis thaliana


Alignment Length:371 Identity:77/371 - (20%)
Similarity:125/371 - (33%) Gaps:114/371 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 GYHSGAGGHGTPSHVSPVGNHLMGAIPEVHKRDKDAIYEHPLFPLLALIFEKC-ELATCTPREPG 124
            |.:...||..|.:.         |.:...:.|.|..|..|||:..|......| .:||...:.|.
plant   136 GENKNDGGGATAAD---------GVVSWQNARHKAEILSHPLYEQLLSAHVACLRIATPVDQLPR 191

  Fly   125 VQGGDVCSSESFNEDIAMFSKQIRSQKPYYTADPEVDSLMVQAIQVL---RFHLLELEKVHELCD 186
            :   |...::| ...:|.:|....:.:.....|.|:|..|...:.:|   :..|.:..:||.:  
plant   192 I---DAQLAQS-QHVVAKYSALGAAAQGLVGDDKELDQFMTHYVLLLCSFKEQLQQHVRVHAM-- 250

  Fly   187 NFCHRYISCLKGKMPIDLVIDERDTTKPPELGSANGEGRSNADSTSHTDGASTPDVRPPSSSLSY 251
               ...::|.:.:..:..:           .|.:.|||                          .
plant   251 ---EAVMACWEIEQSLQSL-----------TGVSPGEG--------------------------M 275

  Fly   252 GGAMNDDARSPGAGSTPGPLSQQPPALDTSDPDGKF----LSSLNPSELTYDGRWCRREWSSPAD 312
            |..|:||             ..:....|.:..||..    ...|.|:|                 
plant   276 GATMSDD-------------EDEQVESDANMFDGGLDVLGFGPLIPTE----------------- 310

  Fly   313 ARNADASRRLYSSVFLGSPDNFGTSASGDASNASIGSGEGTGEEDDDASGKKNQKKR-GIFPKVA 376
                 :.|.|...|               .........:|..|:..|...:..:|:| |..|...
plant   311 -----SERSLMERV---------------RQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDT 355

  Fly   377 TNILRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRR 422
            |::|:||...|...|||:|:.|.:|.|:|||.:.|:||||||.|:|
plant   356 TSVLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hthNP_476576.1 Meis_PKNOX_N 127..211 CDD:406806 13/86 (15%)
Homeobox_KN 383..422 CDD:399131 20/38 (53%)
KNAT3NP_197904.1 KNOX1 160..197 CDD:281744 11/39 (28%)
KNOX2 217..267 CDD:281745 9/65 (14%)
ELK 322..343 CDD:281743 3/20 (15%)
Homeobox_KN 362..401 CDD:283551 20/38 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11850
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X78
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.