DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hth and BLH8

DIOPT Version :9

Sequence 1:NP_476576.1 Gene:hth / 41273 FlyBaseID:FBgn0001235 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_180366.1 Gene:BLH8 / 817343 AraportID:AT2G27990 Length:584 Species:Arabidopsis thaliana


Alignment Length:523 Identity:122/523 - (23%)
Similarity:193/523 - (36%) Gaps:135/523 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 AAAAAMYDPHAGHRPPGLQGLPSHHSPHMTHAAAAAATVGMHGYHSGAGGHGTPSHVSPVGNHLM 83
            :||..|..|.:.||.|  || ||:   ......:..:||. |||.. ||       :.|  |::.
plant    64 SAATFMNMPQSIHRDP--QG-PSN---WRISDLSQPSTVN-HGYDQ-AG-------IRP--NNVA 111

  Fly    84 GAIPEVHKRDKDAIYEHPLF------PLLALIFEKCELATCTPREPGVQGGDVCSSESFNEDIAM 142
            ..:.: |...::.|.:.||:      |..::| .:.|::.....:.|..  .|..|.:.||.:..
plant   112 DLLSD-HFSSRNQILDRPLYVGRDSIPQSSMI-RRSEVSCLDDNQKGCV--TVACSGTGNEILRS 172

  Fly   143 FSKQIRSQKPY---YTADPEVDSLMVQAIQVLRFHLLELEKVHELCDNFCH--------RYISCL 196
            ...|..|...|   ::..|.                ||.:.|.....|:.|        .:.:..
plant   173 SYDQGSSSGSYRGEFSFLPS----------------LENQSVAHNASNWNHGPVNVTATSHTNSK 221

  Fly   197 KGKMPIDLVID---ERDTTKPPELGSANGEG--------RSNADSTSHTDGAS----------TP 240
            || .|:.|:.|   .||......|.:.|..|        .|...|:...:.|.          ..
plant   222 KG-FPLSLLSDIPPSRDVGNAAVLSTMNIHGPLGPFTGYASILKSSRFLEPAQKMLEEFCISYAS 285

  Fly   241 DVRPPSSSLSYGGAMNDDARSPGAGSTPGPLS-----QQPPALDTSDPDGKF-----------LS 289
            .:...|.|.|.....:||....|..|:..||.     ::...|...:...|:           :|
plant   286 KIISRSESTSMEDDDDDDDNLSGFSSSSEPLEPKNRLKKAKLLFLQEEVCKWYKLYNHQLQTVMS 350

  Fly   290 SLNPSELTYDGRWCRREWSSPADARNADASRRLYSSVFLGSPDNFGTSASGDASN-------ASI 347
            |.|    |..|......:.|.|..|.:.:.:.|.:::..........|::|:.:|       :.|
plant   351 SFN----TVAGLNTATPYISLALKRTSRSFKALRTAIAEHVKQISSHSSNGNNNNRFQKRQRSLI 411

  Fly   348 GSGEGTGEEDDDASGKKNQKKRGIFPKVATNILRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQV 412
            |:..|...:.....    :.:||: |:.|..:||||||.|..||||::..|:.||..|||:..||
plant   412 GNNVGFESQQQHIW----RPQRGL-PERAVAVLRAWLFDHFLHPYPTDSDKQMLATQTGLSRNQV 471

  Fly   413 NNWFINARRRIVQPMIDQ--------------------SNRAVYTPHP-------GPSGYGHDAM 450
            :|||||||.|:.:||:::                    |||......|       |.||.....:
plant   472 SNWFINARVRLWKPMVEEIHTLETKAIKNADTSHNIEPSNRPNTVSSPSHEQTLTGLSGTKRSRL 536

  Fly   451 GYM 453
            .||
plant   537 EYM 539

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hthNP_476576.1 Meis_PKNOX_N 127..211 CDD:406806 19/97 (20%)
Homeobox_KN 383..422 CDD:399131 23/38 (61%)
BLH8NP_180366.1 POX 257..385 CDD:214728 23/131 (18%)
Homeobox_KN 442..481 CDD:368670 23/38 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 60 1.000 Domainoid score I3843
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2647
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11850
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X78
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.910

Return to query results.
Submit another query.