DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hth and BLH7

DIOPT Version :10

Sequence 1:NP_476576.1 Gene:hth / 41273 FlyBaseID:FBgn0001235 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_179233.1 Gene:BLH7 / 816137 AraportID:AT2G16400 Length:482 Species:Arabidopsis thaliana


Alignment Length:112 Identity:38/112 - (33%)
Similarity:58/112 - (51%) Gaps:14/112 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 GDASNASIGSGEGTG---EEDDDASGKKNQKKRGI-----------FPKVATNILRAWLFQHLTH 390
            |...:.|.|.|.|..   ..|.....::..::.|:           .|..:..:||||||:|..|
plant   246 GGEQDGSDGRGVGISRLRNVDQQVRQQRALQRLGVMQPHTWRPQRGLPDSSVLVLRAWLFEHFLH 310

  Fly   391 PYPSEDQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVYT 437
            |||.:..|..||:.|||:..||:|||||||.|:.:||:::..:..:|
plant   311 PYPKDSDKIMLARQTGLSRGQVSNWFINARVRLWKPMVEEMYKEEFT 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hthNP_476576.1 Meis_PKNOX_N 127..211 CDD:465140
Homeobox_KN 384..422 CDD:428673 22/37 (59%)
BLH7NP_179233.1 POX 109..236 CDD:214728
Homeobox_KN 304..342 CDD:428673 22/37 (59%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.