DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hth and BLH7

DIOPT Version :9

Sequence 1:NP_476576.1 Gene:hth / 41273 FlyBaseID:FBgn0001235 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_179233.1 Gene:BLH7 / 816137 AraportID:AT2G16400 Length:482 Species:Arabidopsis thaliana


Alignment Length:112 Identity:38/112 - (33%)
Similarity:58/112 - (51%) Gaps:14/112 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 GDASNASIGSGEGTG---EEDDDASGKKNQKKRGI-----------FPKVATNILRAWLFQHLTH 390
            |...:.|.|.|.|..   ..|.....::..::.|:           .|..:..:||||||:|..|
plant   246 GGEQDGSDGRGVGISRLRNVDQQVRQQRALQRLGVMQPHTWRPQRGLPDSSVLVLRAWLFEHFLH 310

  Fly   391 PYPSEDQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVYT 437
            |||.:..|..||:.|||:..||:|||||||.|:.:||:::..:..:|
plant   311 PYPKDSDKIMLARQTGLSRGQVSNWFINARVRLWKPMVEEMYKEEFT 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hthNP_476576.1 Meis_PKNOX_N 127..211 CDD:406806
Homeobox_KN 383..422 CDD:399131 23/38 (61%)
BLH7NP_179233.1 POX 109..236 CDD:214728
Homeobox_KN 303..342 CDD:399131 23/38 (61%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 60 1.000 Domainoid score I3843
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2647
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11850
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X78
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.910

Return to query results.
Submit another query.