DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hth and TGIF1

DIOPT Version :9

Sequence 1:NP_476576.1 Gene:hth / 41273 FlyBaseID:FBgn0001235 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_775299.1 Gene:TGIF1 / 7050 HGNCID:11776 Length:286 Species:Homo sapiens


Alignment Length:101 Identity:39/101 - (38%)
Similarity:60/101 - (59%) Gaps:10/101 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   343 SNASIGSGEGTGEEDDD----------ASGKKNQKKRGIFPKVATNILRAWLFQHLTHPYPSEDQ 397
            |:..|.:..|:..||:|          ::|...:::||..||.:..|||.||::|..:.||||.:
Human    17 SSQGIVAASGSETEDEDSMDIPLDLSSSAGSGKRRRRGNLPKESVQILRDWLYEHRYNAYPSEQE 81

  Fly   398 KKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNR 433
            |..|:|.|.|:.|||.|||||||||::..|:.:..:
Human    82 KALLSQQTHLSTLQVCNWFINARRRLLPDMLRKDGK 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hthNP_476576.1 Meis_PKNOX_N 127..211 CDD:406806
Homeobox_KN 383..422 CDD:399131 22/38 (58%)
TGIF1NP_775299.1 Homeobox_KN 67..106 CDD:283551 22/38 (58%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152642
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2315
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.