DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hth and Pknox2

DIOPT Version :9

Sequence 1:NP_476576.1 Gene:hth / 41273 FlyBaseID:FBgn0001235 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_001258207.1 Gene:Pknox2 / 680549 RGDID:1590611 Length:475 Species:Rattus norvegicus


Alignment Length:455 Identity:162/455 - (35%)
Similarity:217/455 - (47%) Gaps:127/455 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PPGLQGLPSHHSPHMT------------HAAAAAATVGMHGYHSGAGGHGTPSHVSPVGNHLMGA 85
            ||     |...||.||            |.||.:||.            .||...:|:.      
  Rat    21 PP-----PYQDSPQMTATAQPPSKAQAVHIAAPSATA------------STPVPSAPID------ 62

  Fly    86 IPEVH-KRDKDAIYEHPLFPLLALIFEKCELATCTPREPGVQGGDVCSSESFNEDIAMF-SKQIR 148
             |:.. :.||.|:|.|||||||.|:|||||.||        ||.:..:|.||:.||..| .:|.:
  Rat    63 -PQAQLEADKRAVYRHPLFPLLTLLFEKCEQAT--------QGSECITSASFDVDIENFVHQQEQ 118

  Fly   149 SQKPYYTADPEVDSLMVQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDTTK 213
            ..||:::.|||:|:|||:||||||.||||||||:|||.:||:|||:|||.||..|.:: ..|...
  Rat   119 EHKPFFSDDPELDNLMVKAIQVLRIHLLELEKVNELCKDFCNRYITCLKTKMHSDNLL-RNDLGG 182

  Fly   214 P-----PELGSANGEGRSNADSTSHTDGASTPDVRPPSSSLSYGG----AMNDDARSPGAGSTPG 269
            |     |.:...:.:...|:.::......:...:..|:|:|..|.    .:|....|.||     
  Rat   183 PYSPNQPSINLHSQDLLQNSPNSMSGVSNNPQGIVVPASALQQGNIAMTTVNSQVVSGGA----- 242

  Fly   270 PLSQQPPALDTSDPDGKFLSSLNPSELTYDGRWCRREWSSPADARNADASRRLYSSVFLGSPDNF 334
              ..||..:.||  .|:.::...|              ......:|...:..|.|.:     || 
  Rat   243 --LYQPVTMVTS--QGQVVTQAIP--------------QGAIQIQNTQVNLDLTSLL-----DN- 283

  Fly   335 GTSASGDASNASIGSGEGTGEEDDDASGKKNQKKRGIFPKVATNILRAWLFQHLTHPYPSEDQKK 399
                                 ||     ||::.|||:.||.||||:|:||||||.||||:||:|:
  Rat   284 ---------------------ED-----KKSKNKRGVLPKHATNIMRSWLFQHLMHPYPTEDEKR 322

  Fly   400 QLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVYTPHPGPSGYGHDAMGYMMDSQAHMMHRP 464
            |:|..|.||:||||||||||||||:|||:|.||     |.|.|..           .:....|||
  Rat   323 QIAAQTNLTLLQVNNWFINARRRILQPMLDASN-----PDPAPKA-----------KKIKSQHRP 371

  Fly   465  464
              Rat   372  371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hthNP_476576.1 Meis_PKNOX_N 127..211 CDD:406806 45/84 (54%)
Homeobox_KN 383..422 CDD:399131 29/38 (76%)
Pknox2NP_001258207.1 gliding_GltG 5..>77 CDD:411344 20/79 (25%)
Meis_PKNOX_N 96..181 CDD:406806 46/85 (54%)
Homeobox_KN 306..345 CDD:399131 29/38 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346169
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000410
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X78
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.740

Return to query results.
Submit another query.