DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hth and TGIF2

DIOPT Version :9

Sequence 1:NP_476576.1 Gene:hth / 41273 FlyBaseID:FBgn0001235 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_001186442.1 Gene:TGIF2 / 60436 HGNCID:15764 Length:237 Species:Homo sapiens


Alignment Length:151 Identity:45/151 - (29%)
Similarity:72/151 - (47%) Gaps:17/151 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   343 SNASIGSGEGTGEEDDDASGKKNQKKRGIFPKVATNILRAWLFQHLTHPYPSEDQKKQLAQDTGL 407
            |::.:|..||.    ...:||:  |:||..||.:..|||.||:.|..:.||||.:|..|:..|.|
Human     2 SDSDLGEDEGL----LSLAGKR--KRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNL 60

  Fly   408 TILQVNNWFINARRRIVQPMIDQS----NRAVYTPHPG-------PSGYGHDAMGYMMDSQAHMM 461
            ::||:.|||||||||::..|:.:.    |:...:...|       |.|.....:...:.:..:::
Human    61 SVLQICNWFINARRRLLPDMLRKDGKDPNQFTISRRGGKASDVALPRGSSPSVLAVSVPAPTNVL 125

  Fly   462 HRPPGDPGFHQGYPHYPPAEY 482
            .........|.|....|.|.:
Human   126 SLSVCSMPLHSGQGEKPAAPF 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hthNP_476576.1 Meis_PKNOX_N 127..211 CDD:406806
Homeobox_KN 383..422 CDD:399131 20/38 (53%)
TGIF2NP_001186442.1 Homeobox_KN 36..75 CDD:399131 20/38 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 87..106 2/18 (11%)
Repressive function 103..237 6/44 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 172..193
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 213..237
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152638
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.