DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hth and PBX1

DIOPT Version :9

Sequence 1:NP_476576.1 Gene:hth / 41273 FlyBaseID:FBgn0001235 Length:487 Species:Drosophila melanogaster
Sequence 2:XP_005245285.1 Gene:PBX1 / 5087 HGNCID:8632 Length:486 Species:Homo sapiens


Alignment Length:242 Identity:55/242 - (22%)
Similarity:80/242 - (33%) Gaps:97/242 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 AGSTPG-PLSQQP----PALDTSDPDGKFLSSLNPSELTYDGRWCRREWSSPADARNADASRRLY 323
            :.||.| |::.||    |:....  :||.||.....|            ..|.|.:.......|.
Human   119 SASTSGNPVTPQPTHHHPSFGWG--EGKVLSIRGAQE------------EEPTDPQLMRLDNMLL 169

  Fly   324 SSVFLGSPDNFGTSASGDASNASIGSGEGTGEEDDDASGKKNQ---------------------- 366
            :....|.....|::|:..|:.||.|:|.....|..|...|.:|                      
Human   170 AEGVAGPEKGGGSAAAAAAAAASGGAGSDNSVEHSDYRAKLSQIRQIYHTELEKYEQACNEFTTH 234

  Fly   367 --------------------------------------------------------KKRGIFPKV 375
                                                                    :||..|.|.
Human   235 VMNLLREQSRTRPISPKEIERMVSIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFNKQ 299

  Fly   376 ATNILRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRR 422
            ||.||..:.:.||::|||||:.|::||:..|:|:.||:|||.|.|.|
Human   300 ATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIR 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hthNP_476576.1 Meis_PKNOX_N 127..211 CDD:406806
Homeobox_KN 383..422 CDD:399131 19/38 (50%)
PBX1XP_005245285.1 PBC 40..288 CDD:281746 27/182 (15%)
homeodomain 290..350 CDD:238039 28/57 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152645
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X78
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.