Sequence 1: | NP_476576.1 | Gene: | hth / 41273 | FlyBaseID: | FBgn0001235 | Length: | 487 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005245285.1 | Gene: | PBX1 / 5087 | HGNCID: | 8632 | Length: | 486 | Species: | Homo sapiens |
Alignment Length: | 242 | Identity: | 55/242 - (22%) |
---|---|---|---|
Similarity: | 80/242 - (33%) | Gaps: | 97/242 - (40%) |
- Green bases have known domain annotations that are detailed below.
Fly 264 AGSTPG-PLSQQP----PALDTSDPDGKFLSSLNPSELTYDGRWCRREWSSPADARNADASRRLY 323
Fly 324 SSVFLGSPDNFGTSASGDASNASIGSGEGTGEEDDDASGKKNQ---------------------- 366
Fly 367 --------------------------------------------------------KKRGIFPKV 375
Fly 376 ATNILRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRR 422 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
hth | NP_476576.1 | Meis_PKNOX_N | 127..211 | CDD:406806 | |
Homeobox_KN | 383..422 | CDD:399131 | 19/38 (50%) | ||
PBX1 | XP_005245285.1 | PBC | 40..288 | CDD:281746 | 27/182 (15%) |
homeodomain | 290..350 | CDD:238039 | 28/57 (49%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165152645 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X78 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.840 |