DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hth and IRX4

DIOPT Version :9

Sequence 1:NP_476576.1 Gene:hth / 41273 FlyBaseID:FBgn0001235 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_001265562.1 Gene:IRX4 / 50805 HGNCID:6129 Length:545 Species:Homo sapiens


Alignment Length:229 Identity:65/229 - (28%)
Similarity:91/229 - (39%) Gaps:37/229 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 GRSNADSTSHTDGASTPDVRPPSSSLSYGGAMNDDARSPGAGSTPGPL--SQQPPALDTSDPDGK 286
            ||:.||| .....|..|...|...|.....|.::...:...|...||.  ||......|...:..
Human    31 GRTLADS-GPAASAQAPVYCPVYESRLLATARHELNSAAALGVYGGPYGGSQGYGNYVTYGSEAS 94

  Fly   287 FLSSLNPSELTYDGRWCRREWSSPADAR-----------NADASRRLYSSVFLGSP-DNFGTSAS 339
            ...|||..: :.||........:||.|.           ..|..:||.     |.| ...|...|
Human    95 AFYSLNSFD-SKDGSGSAHGGLAPAAAAYYPYEPALGQYPYDRIKRLG-----GHPHKGIGLDLS 153

  Fly   340 GDASNASIGSGEGTGEEDDDASGKKNQKKRGIFPKVATNILRAWLFQHLTHPYPSEDQKKQLAQD 404
            |  ...|.||..||   .|..:.:||..:.      .|:.|:|||.:|..:|||::.:|..||..
Human   154 G--LGRSPGSLYGT---MDSGTRRKNATRE------TTSTLKAWLQEHRKNPYPTKGEKIMLAII 207

  Fly   405 TGLTILQVNNWFINARRRIVQPMIDQSNRAVYTP 438
            |.:|:.||:.||.|||||     :.:.|:..:.|
Human   208 TKMTLTQVSTWFANARRR-----LKKENKMTWPP 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hthNP_476576.1 Meis_PKNOX_N 127..211 CDD:406806
Homeobox_KN 383..422 CDD:399131 18/38 (47%)
IRX4NP_001265562.1 Homeobox_KN 186..225 CDD:368670 18/38 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.