DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hth and Tgif2

DIOPT Version :9

Sequence 1:NP_476576.1 Gene:hth / 41273 FlyBaseID:FBgn0001235 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_001128455.1 Gene:Tgif2 / 499929 RGDID:1560115 Length:237 Species:Rattus norvegicus


Alignment Length:155 Identity:46/155 - (29%)
Similarity:72/155 - (46%) Gaps:25/155 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   343 SNASIGSGEG----TGEEDDDASGKKNQKKRGIFPKVATNILRAWLFQHLTHPYPSEDQKKQLAQ 403
            |::.:|..||    ||:          :|:||..||.:..|||.||:.|..:.||||.:|..|:.
  Rat     2 SDSDLGEDEGLLSLTGK----------RKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSG 56

  Fly   404 DTGLTILQVNNWFINARRRIVQPMIDQS----NRAVYTPHPG-------PSGYGHDAMGYMMDSQ 457
            .|.|::||:.|||||||||::..|:.:.    |:...:...|       |.|.....:...:.:.
  Rat    57 QTNLSVLQICNWFINARRRLLPDMLRKDGKDPNQFTISRRGGKASDVALPRGSSPSLLAVSVPAP 121

  Fly   458 AHMMHRPPGDPGFHQGYPHYPPAEY 482
            .:|:.........|.|....|.|.:
  Rat   122 TNMLSLSVCSMPLHSGQGEKPAASF 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hthNP_476576.1 Meis_PKNOX_N 127..211 CDD:406806
Homeobox_KN 383..422 CDD:399131 20/38 (53%)
Tgif2NP_001128455.1 Homeobox_KN 36..75 CDD:399131 20/38 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346160
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.