Sequence 1: | NP_476576.1 | Gene: | hth / 41273 | FlyBaseID: | FBgn0001235 | Length: | 487 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001018329.2 | Gene: | irx4b / 474318 | ZFINID: | ZDB-GENE-040712-4 | Length: | 439 | Species: | Danio rerio |
Alignment Length: | 197 | Identity: | 50/197 - (25%) |
---|---|---|---|
Similarity: | 76/197 - (38%) | Gaps: | 46/197 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 277 ALDTS-DPDGKFLSSLNPSE-------LTYDGRW---CRREWSSPADARNADASRRLYSSVFLGS 330
Fly 331 PDNFGTSASG---DASNASIGSGEGT------------GEEDDDASG---------KKNQKKRGI 371
Fly 372 FPKVATNILRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVY 436
Fly 437 TP 438 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
hth | NP_476576.1 | Meis_PKNOX_N | 127..211 | CDD:406806 | |
Homeobox_KN | 383..422 | CDD:399131 | 18/38 (47%) | ||
irx4b | NP_001018329.2 | Homeobox_KN | 157..196 | CDD:283551 | 18/38 (47%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0773 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |