DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hth and Pbx2

DIOPT Version :9

Sequence 1:NP_476576.1 Gene:hth / 41273 FlyBaseID:FBgn0001235 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_001002828.1 Gene:Pbx2 / 406164 RGDID:1303084 Length:430 Species:Rattus norvegicus


Alignment Length:148 Identity:40/148 - (27%)
Similarity:65/148 - (43%) Gaps:30/148 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   366 QKKRGIFPKVATNILRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINAR---RRIVQPM 427
            ::||..|.|.||.:|..:.:.||::|||||:.|::||:..|:|:.||:|||.|.|   ::.:...
  Rat   245 RRKRRNFSKQATEVLNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKF 309

  Fly   428 IDQSNRAVY---------------TPHPGPSGYGHDAMGYMMDSQAHMMHRPPGDPGFHQGYP-- 475
            .:::|  :|               |..|.|.........:.:.....|....||..|  ..||  
  Rat   310 QEEAN--IYAVKTAVSVAQGGHSRTSSPTPPSSAGSGGSFNLSGSGDMFLGMPGLNG--DSYPAS 370

  Fly   476 ------HYPPAEYYGQHL 487
                  |......||.::
  Rat   371 QVESLRHSMGPASYGDNI 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hthNP_476576.1 Meis_PKNOX_N 127..211 CDD:406806
Homeobox_KN 383..422 CDD:399131 19/41 (46%)
Pbx2NP_001002828.1 PBC 50..243 CDD:281746
homeodomain 245..305 CDD:238039 26/59 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346156
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X78
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.