DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hth and mirr

DIOPT Version :9

Sequence 1:NP_476576.1 Gene:hth / 41273 FlyBaseID:FBgn0001235 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_001261778.1 Gene:mirr / 39441 FlyBaseID:FBgn0014343 Length:682 Species:Drosophila melanogaster


Alignment Length:362 Identity:82/362 - (22%)
Similarity:118/362 - (32%) Gaps:139/362 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 GEGRSNADSTSHTDGASTPDVRPPSS---SLSYGGAMNDDARSPGAGSTPGPLSQQPP--ALDT- 280
            |.|.|...:::...||.:.....||:   :||..||......|...|..|.|.:..||  ..|| 
  Fly    59 GPGHSGMVTSTVPPGARSTSPCGPSAGLPALSLVGAPPPGPHSSAPGGAPAPGAGNPPNRCCDTG 123

  Fly   281 ----SDP-DGKFLSSLNPSELTY---------------DGRWCRRE---------WSSPADARNA 316
                :|| .|:.:.|.....|.|               :|......         :::||   ..
  Fly   124 RTIYTDPVSGQTICSCQYDMLNYQRLAAAGGVPLGVYPEGMSAYLSGIAADQPPFYANPA---GI 185

  Fly   317 DASRRL---------------YSSVFLGSPDN-FGTSASGDASNASIGSGEGTGEEDDDASGKKN 365
            |....|               |.:.|.|.|.| :|...:|                    :.:||
  Fly   186 DLKENLVAGASPWPYPSMYHPYDAAFAGYPFNSYGMDLNG--------------------ARRKN 230

  Fly   366 QKKRGIFPKVATNILRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQ 430
            ..:.      .|:.|:|||.:|..:|||::.:|..||..|.:|:.||:.||.|||||     :.:
  Fly   231 ATRE------TTSTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRR-----LKK 284

  Fly   431 SNRAVYTPH-------------------------PGPSGYG----HDAMGYMMDSQAHMMHRPPG 466
            .|:..:.|.                         ...||.|    .|..|.:.|    ||...||
  Fly   285 ENKMTWEPRNRVDDDDANIDDDDDKNTEDNDLLDAKDSGVGSTDDKDRSGRLGD----MMTDRPG 345

  Fly   467 D----------PGFHQGYP-------HYPPAEYYGQH 486
            :          ||...|.|       ..||    |.|
  Fly   346 ESNNSEWSESRPGSPNGSPDLYDRPGSMPP----GAH 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hthNP_476576.1 Meis_PKNOX_N 127..211 CDD:406806
Homeobox_KN 383..422 CDD:399131 18/38 (47%)
mirrNP_001261778.1 Homeobox_KN 242..281 CDD:283551 18/38 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.