DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hth and ara

DIOPT Version :9

Sequence 1:NP_476576.1 Gene:hth / 41273 FlyBaseID:FBgn0001235 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_524045.2 Gene:ara / 39439 FlyBaseID:FBgn0015904 Length:717 Species:Drosophila melanogaster


Alignment Length:352 Identity:78/352 - (22%)
Similarity:116/352 - (32%) Gaps:95/352 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 GKMPIDLV----IDERDTTKPPELGSANGEG----RSNADSTSHTDGASTPDVRPPSSSLSYGGA 254
            |..|.||.    :|.......|..|.|.|.|    ......|....|.:....:..|:.|:....
  Fly   100 GGGPADLATGGSLDGNGVGTTPTAGGAGGGGSCCENGRPIMTDPVSGQTVCSCQYDSARLALSSY 164

  Fly   255 MNDDARSPGAGSTPGPLSQQPPALDTSDPDGKFLSSLNPSELTYDGRWCRREWSSPADARNADAS 319
            ....|.|.|...||.|.:.|.|..........|.|.|                |:|...::..|.
  Fly   165 SRLPAASVGVYGTPYPSTDQNPYQSIGVDSSAFYSPL----------------SNPYGLKDTGAG 213

  Fly   320 RRLYSSVFLGSPDNFG------TSASGD--ASNASIGSGEGTGEEDDDASGKKNQKKRGIFPKVA 376
            ..:.:....|.....|      .||.|.  .||:|.|:..      |.|:.:||..:.      :
  Fly   214 PEMGAWTSAGLQPTTGYYSYDPMSAYGGLLVSNSSYGASY------DLAARRKNATRE------S 266

  Fly   377 TNILRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRRI------------------ 423
            |..|:|||.:|..:|||::.:|..||..|.:|:.||:.||.|||||:                  
  Fly   267 TATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWEPKNRTDDDD 331

  Fly   424 -------------VQP--------------------MIDQSNRAVYTPHPGPSGYGHDAMGYMMD 455
                         ::|                    .||:..:.:...:...:|:|:.:.|....
  Fly   332 DALVSDDEKDKEDLEPSKGSQGSVSLAKDETKEEEDAIDEDQKCLGQANILRAGFGYPSAGSGSG 396

  Fly   456 SQAHMMHRPPGDPGFHQGYPHYPPAEY 482
            ..........|.||.:..|.|..||.|
  Fly   397 GYPGGGGSSSGHPGGYHPYHHQHPAYY 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hthNP_476576.1 Meis_PKNOX_N 127..211 CDD:406806 5/16 (31%)
Homeobox_KN 383..422 CDD:399131 18/38 (47%)
araNP_524045.2 Homeobox_KN 273..312 CDD:283551 18/38 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.