DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hth and achi

DIOPT Version :10

Sequence 1:NP_476576.1 Gene:hth / 41273 FlyBaseID:FBgn0001235 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_725183.1 Gene:achi / 36373 FlyBaseID:FBgn0033749 Length:555 Species:Drosophila melanogaster


Alignment Length:125 Identity:43/125 - (34%)
Similarity:56/125 - (44%) Gaps:41/125 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   345 ASIGSGEGTG-------------------EEDDDASGKKNQ----------------------KK 368
            ||:...||.|                   |||.......||                      |:
  Fly    32 ASLLENEGRGRFHSDSSLDQDSLHADVIVEEDQSTEHGANQVQNYHDMMVDSEHHIDINGSLRKR 96

  Fly   369 RGIFPKVATNILRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 428
            ||..||.:..||:.||::|..:.|||:.:|..|:|:..||:|||.||||||||||:..||
  Fly    97 RGNLPKTSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRILPEMI 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hthNP_476576.1 Meis_PKNOX_N 127..211 CDD:465140
Homeobox_KN 384..422 CDD:428673 20/37 (54%)
achiNP_725183.1 Homeobox_KN 112..150 CDD:428673 20/37 (54%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.