DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hth and achi

DIOPT Version :9

Sequence 1:NP_476576.1 Gene:hth / 41273 FlyBaseID:FBgn0001235 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_001286352.1 Gene:achi / 36373 FlyBaseID:FBgn0033749 Length:555 Species:Drosophila melanogaster


Alignment Length:125 Identity:43/125 - (34%)
Similarity:56/125 - (44%) Gaps:41/125 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   345 ASIGSGEGTG-------------------EEDDDASGKKNQ----------------------KK 368
            ||:...||.|                   |||.......||                      |:
  Fly    32 ASLLENEGRGRFHSDSSLDQDSLHADVIVEEDQSTEHGANQVQNYHDMMVDSEHHIDINGSLRKR 96

  Fly   369 RGIFPKVATNILRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 428
            ||..||.:..||:.||::|..:.|||:.:|..|:|:..||:|||.||||||||||:..||
  Fly    97 RGNLPKTSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRILPEMI 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hthNP_476576.1 Meis_PKNOX_N 127..211 CDD:406806
Homeobox_KN 383..422 CDD:399131 21/38 (55%)
achiNP_001286352.1 Homeobox_KN 111..150 CDD:283551 21/38 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457277
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9183
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.