DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hth and Tgif1

DIOPT Version :9

Sequence 1:NP_476576.1 Gene:hth / 41273 FlyBaseID:FBgn0001235 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_001015020.1 Gene:Tgif1 / 316742 RGDID:1310517 Length:287 Species:Rattus norvegicus


Alignment Length:117 Identity:43/117 - (36%)
Similarity:62/117 - (52%) Gaps:24/117 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   329 GSPDNFGTSASGDASNASIGSGEGTGEEDDD------------ASGKKNQKKRGIFPKVATNILR 381
            |.|...|.          :.:..|:..||:|            ||||:  ::||..||.:..|||
  Rat    14 GWPSRHGV----------VAAASGSDSEDEDSMDSPLDLSSSAASGKR--RRRGNLPKESVQILR 66

  Fly   382 AWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNR 433
            .||::|..:.||||.:|..|:|.|.|:.|||.|||||||||::..|:.:..:
  Rat    67 DWLYEHRYNAYPSEQEKALLSQQTHLSTLQVCNWFINARRRLLPDMLRKDGK 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hthNP_476576.1 Meis_PKNOX_N 127..211 CDD:406806
Homeobox_KN 383..422 CDD:399131 22/38 (58%)
Tgif1NP_001015020.1 Homeobox_KN 68..107 CDD:283551 22/38 (58%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346163
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.