DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hth and Tgif1

DIOPT Version :10

Sequence 1:NP_476576.1 Gene:hth / 41273 FlyBaseID:FBgn0001235 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_001015020.1 Gene:Tgif1 / 316742 RGDID:1310517 Length:287 Species:Rattus norvegicus


Alignment Length:117 Identity:43/117 - (36%)
Similarity:62/117 - (52%) Gaps:24/117 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   329 GSPDNFGTSASGDASNASIGSGEGTGEEDDD------------ASGKKNQKKRGIFPKVATNILR 381
            |.|...|.          :.:..|:..||:|            ||||:  ::||..||.:..|||
  Rat    14 GWPSRHGV----------VAAASGSDSEDEDSMDSPLDLSSSAASGKR--RRRGNLPKESVQILR 66

  Fly   382 AWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNR 433
            .||::|..:.||||.:|..|:|.|.|:.|||.|||||||||::..|:.:..:
  Rat    67 DWLYEHRYNAYPSEQEKALLSQQTHLSTLQVCNWFINARRRLLPDMLRKDGK 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hthNP_476576.1 Meis_PKNOX_N 127..211 CDD:465140
Homeobox_KN 384..422 CDD:428673 21/37 (57%)
Tgif1NP_001015020.1 Homeobox_KN 69..107 CDD:428673 21/37 (57%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.