DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hth and Irx1

DIOPT Version :9

Sequence 1:NP_476576.1 Gene:hth / 41273 FlyBaseID:FBgn0001235 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_001100801.1 Gene:Irx1 / 306659 RGDID:1309060 Length:480 Species:Rattus norvegicus


Alignment Length:196 Identity:50/196 - (25%)
Similarity:79/196 - (40%) Gaps:55/196 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 ARSPGA--GSTPGPLSQQPPALDTSDPDGKFLSSLNPSELTYDGRWCRREWSSPADARNADASRR 321
            |..|||  |..||.|:....|...:.                .||....|..:.|.|....:...
  Rat    14 AAGPGAYGGERPGMLAAAAAAAAAAS----------------SGRPGTAELGAGAGAAAVTSVLG 62

  Fly   322 LYSSV--FLGSPDNFGTSASGDASNASIGSGEGTGEEDDDASG---------------------- 362
            :|::.  :.|:| |: ::....|::.|:.|..|:..|..|..|                      
  Rat    63 MYAAAGPYAGAP-NY-SAFLPYAADLSLFSQMGSQYELKDNPGVHPATFAAHTTPAYYPYGQFQY 125

  Fly   363 -----KKNQKKRGIFPKVATNILRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRR 422
                 .||..:.      :|:.|:|||.:|..:|||::.:|..||..|.:|:.||:.||.|||||
  Rat   126 GDPGRPKNATRE------STSTLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRR 184

  Fly   423 I 423
            :
  Rat   185 L 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hthNP_476576.1 Meis_PKNOX_N 127..211 CDD:406806
Homeobox_KN 383..422 CDD:399131 18/38 (47%)
Irx1NP_001100801.1 Homeobox_KN 145..184 CDD:283551 18/38 (47%)
SDA1 <194..>252 CDD:283052
IRO 309..326 CDD:214716
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.