DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hth and meis2b

DIOPT Version :9

Sequence 1:NP_476576.1 Gene:hth / 41273 FlyBaseID:FBgn0001235 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_570985.1 Gene:meis2b / 30066 ZFINID:ZDB-GENE-000210-23 Length:393 Species:Danio rerio


Alignment Length:478 Identity:247/478 - (51%)
Similarity:286/478 - (59%) Gaps:111/478 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAQPRYDDGLH-GYGMDSGAAAAAMY-DPHAGHRPPGLQGLPSHHSPHMTHAAAAAAT--VGMHG 61
            ||| ||:|..| |.|||......:|| |||| .||     ||..|  |:.|.....|.  .|.|.
Zfish     3 MAQ-RYEDLAHYGGGMDGVGVPTSMYGDPHA-PRP-----LPQVH--HLNHGPPPHANQHYGAHA 58

  Fly    62 YHSGAGGHGTPSHVSPVGNHLMGAIPEVHKRDKDAIYEHPLFPLLALIFEKCELATCTPREPGVQ 126
            .||          :.|  :.:..|:.:..|||||.||.|||||||||:||||||||||||||||.
Zfish    59 PHS----------IMP--SSMGSAVNDALKRDKDQIYGHPLFPLLALVFEKCELATCTPREPGVA 111

  Fly   127 GGDVCSSESFNEDIAMFSKQIRSQKPYYTADPEVDSLMVQAIQVLRFHLLELEKVHELCDNFCHR 191
            |||||||:|||||||:|:||||::||.::::||:|:||:|:||||||||||||||||||||||||
Zfish   112 GGDVCSSDSFNEDIAVFAKQIRAEKPLFSSNPELDNLMIQSIQVLRFHLLELEKVHELCDNFCHR 176

  Fly   192 YISCLKGKMPIDLVIDERDTTKPPELGSANGEGRSNADSTSHTDGASTPDVRPPSSSLSYGGAMN 256
            |||||||||||||||||||..| .:....:|...:.||.    :.||..|:              
Zfish   177 YISCLKGKMPIDLVIDERDGCK-SDFDDLSGSSTNLADH----NPASWRDM-------------- 222

  Fly   257 DDARSPGAGSTPGPLSQQPPALDTSDPDGKFLSSLNPSELTYDGRWCRREWSSPADARNADASRR 321
            |||.|..:..||||.|                                          ...||: 
Zfish   223 DDAHSTPSVGTPGPSS------------------------------------------GGHASQ- 244

  Fly   322 LYSSVFLGSPDNFGTSASGDASNASIGSGEGTGEEDDDASGKKNQKKRGIFPKVATNILRAWLFQ 386
                    |.||  :|..||..:.|:.| .|||:|||  ..||.||||||||||||||:||||||
Zfish   245 --------SGDN--SSELGDGLDNSLAS-PGTGDEDD--QDKKRQKKRGIFPKVATNIMRAWLFQ 296

  Fly   387 HLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAV-----YTPHPGPSGYG 446
            |||||||||:||||||||||||.||||||||||||||||||||||||||     |:|...|.|  
Zfish   297 HLTHPYPSEEQKKQLAQDTGLTNLQVNNWFINARRRIVQPMIDQSNRAVSQGTAYSPDGQPMG-- 359

  Fly   447 HDAMGYMMDSQAHMMHRPPGDPG 469
                |:::|.|.||..||.|..|
Zfish   360 ----GFVLDGQQHMGLRPGGPMG 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hthNP_476576.1 Meis_PKNOX_N 127..211 CDD:406806 69/83 (83%)
Homeobox_KN 383..422 CDD:399131 36/38 (95%)
meis2bNP_570985.1 Meis_PKNOX_N 112..195 CDD:293102 68/82 (83%)
Homeobox_KN 293..332 CDD:283551 36/38 (95%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587119
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1126341at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2315
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.