DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hth and Pknox1

DIOPT Version :9

Sequence 1:NP_476576.1 Gene:hth / 41273 FlyBaseID:FBgn0001235 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_001013092.1 Gene:Pknox1 / 294322 RGDID:1305003 Length:436 Species:Rattus norvegicus


Alignment Length:382 Identity:146/382 - (38%)
Similarity:194/382 - (50%) Gaps:86/382 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 DKDAIYEHPLFPLLALIFEKCELATCTPREPGVQGGDVCSSESFNEDIAMF-SKQIRSQKPYYTA 156
            ||.|||.|||||||||:|||||.:|        ||.:..:|.||:.||..| .||.:..||::..
  Rat    54 DKQAIYRHPLFPLLALLFEKCEQST--------QGSEGTTSASFDVDIENFVRKQEKDGKPFFCE 110

  Fly   157 DPEVDSLMVQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDTTKPPELGSAN 221
            |||.|:|||:||||||.||||||||:|||.:||.|||:|||.||       ..:|....|.||..
  Rat   111 DPETDNLMVKAIQVLRIHLLELEKVNELCKDFCSRYIACLKTKM-------NSETLLSGEPGSPY 168

  Fly   222 GEGRSNADSTSHTDGASTPDVRPPSSSLSYGGAMNDDARSPGAGSTPGPLSQQPPALDTSDPDGK 286
            ...:|....::.|...|...:..|:|:|..|..    ..:..||.|    ..||..:.|  |.|:
  Rat   169 SPVQSQQIQSAITGTLSPQGIVVPASALQQGNV----TMATVAGGT----VYQPVTVVT--PQGQ 223

  Fly   287 FLS-SLNPSELTYDGRWCRREWSSPADARNADASRRLYSSVFLGSPDNFGTSASGDASNASIGSG 350
            .:: :|:|..:.               .:|:....:|...:.:                      
  Rat   224 VVTQALSPGTIR---------------IQNSQLQLQLNQDLSI---------------------- 251

  Fly   351 EGTGEEDDDASGKKNQKKRGIFPKVATNILRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNW 415
                ...:|.|.|   .|||:.||.|||::|:|||||:.||||:||:|||:|..|.||:||||||
  Rat   252 ----LHQEDGSSK---NKRGVLPKHATNVMRSWLFQHIGHPYPTEDEKKQIAAQTNLTLLQVNNW 309

  Fly   416 FINARRRIVQPMIDQS-------------NRAV--YTPHPGPSGYGHDAMGYMMDSQ 457
            ||||||||:|||:|.|             ||.|  :.|....||......|.:..|:
  Rat   310 FINARRRILQPMLDSSCSETPKTKKKPAQNRPVQRFWPDSLASGVAQATPGELAMSE 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hthNP_476576.1 Meis_PKNOX_N 127..211 CDD:406806 45/84 (54%)
Homeobox_KN 383..422 CDD:399131 29/38 (76%)
Pknox1NP_001013092.1 Meis_PKNOX_N 80..165 CDD:406806 47/91 (52%)
Homeobox_KN 277..316 CDD:399131 29/38 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346165
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000410
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X78
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.740

Return to query results.
Submit another query.