DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hth and psa-3

DIOPT Version :9

Sequence 1:NP_476576.1 Gene:hth / 41273 FlyBaseID:FBgn0001235 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_001076765.2 Gene:psa-3 / 181631 WormBaseID:WBGene00009560 Length:275 Species:Caenorhabditis elegans


Alignment Length:127 Identity:37/127 - (29%)
Similarity:63/127 - (49%) Gaps:20/127 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 VSPVGNHLMGAIPEVHKRDKDAIYE----HPLFPLLALIFEKCELATCTPREPGVQGGDVCSSES 135
            :||...::..  |:     |.|::|    |||.|::.|:.||||.|..|......:..|:   :.
 Worm    42 ISPTATNIKS--PK-----KSALFEKIASHPLMPIVELLLEKCETAATTFDRKAFETDDI---KR 96

  Fly   136 FNEDIAMFSKQIRSQKPYYTADPEVDSLMVQAIQVLRFHLLELEKVHELCDNFCHRYISCLK 197
            ..:.:.....|:.|.:      .|||.||..||..||..::|||:|:.|.::|..:|::.|:
 Worm    97 LFQSLEQRGVQLSSNR------DEVDELMETAILALRTCMVELERVYSLMESFKAKYLATLR 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hthNP_476576.1 Meis_PKNOX_N 127..211 CDD:406806 20/71 (28%)
Homeobox_KN 383..422 CDD:399131
psa-3NP_001076765.2 Meis_PKNOX_N 92..152 CDD:374576 19/68 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.